DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and GSTZ1

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001350632.1 Gene:GSTZ1 / 2954 HGNCID:4643 Length:217 Species:Homo sapiens


Alignment Length:207 Identity:42/207 - (20%)
Similarity:77/207 - (37%) Gaps:44/207 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KGTLYTYPENFRAYKALIAAQYSGAQVKVA--DNFKFGETNKSAEFLKKFPGGKVPAFETAEGQY 65
            |..||:|..:..:::..||....|...:..  :..|.|....|.:|....|..:||..: .:|..
Human     6 KPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLK-IDGIT 69

  Fly    66 LSESNAIAYLLANEQLRGGKCPFVQAQVQQWISFADNEIVP------ASCAWVFPLL--GILPQQ 122
            :.:|.||...|  |::|                 ....::|      ||...:..|:  ||.|.|
Human    70 IHQSLAIIEYL--EEMR-----------------PTPRLLPQDPKKRASVRMISDLIAGGIQPLQ 115

  Fly   123 KNSTAKQEAEAV------------LQQLNQKLQDAT--FLAGERITLADIVVFSSLLHLYEYVLE 173
            ..|..||..|.:            ...|.|.||...  :..|:.:|:||:.:...:.:...:.::
Human   116 NLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVD 180

  Fly   174 PSVRSAFGNVNR 185
            .:......::|:
Human   181 LTPYPTISSINK 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 18/76 (24%)
GstA 5..187 CDD:223698 41/205 (20%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 21/118 (18%)
EF1G 271..376 CDD:279041
GSTZ1NP_001350632.1 maiA 8..212 CDD:273527 41/205 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.