Sequence 1: | NP_001189308.1 | Gene: | eEF1gamma / 44791 | FlyBaseID: | FBgn0029176 | Length: | 431 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001350632.1 | Gene: | GSTZ1 / 2954 | HGNCID: | 4643 | Length: | 217 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 42/207 - (20%) |
---|---|---|---|
Similarity: | 77/207 - (37%) | Gaps: | 44/207 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KGTLYTYPENFRAYKALIAAQYSGAQVKVA--DNFKFGETNKSAEFLKKFPGGKVPAFETAEGQY 65
Fly 66 LSESNAIAYLLANEQLRGGKCPFVQAQVQQWISFADNEIVP------ASCAWVFPLL--GILPQQ 122
Fly 123 KNSTAKQEAEAV------------LQQLNQKLQDAT--FLAGERITLADIVVFSSLLHLYEYVLE 173
Fly 174 PSVRSAFGNVNR 185 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
eEF1gamma | NP_001189308.1 | GST_N_EF1Bgamma | 4..79 | CDD:239342 | 18/76 (24%) |
GstA | 5..187 | CDD:223698 | 41/205 (20%) | ||
GST_C_EF1Bgamma_like | 90..209 | CDD:198290 | 21/118 (18%) | ||
EF1G | 271..376 | CDD:279041 | |||
GSTZ1 | NP_001350632.1 | maiA | 8..212 | CDD:273527 | 41/205 (20%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |