DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and GSTT4

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001345593.1 Gene:GSTT4 / 25774 HGNCID:26930 Length:241 Species:Homo sapiens


Alignment Length:149 Identity:39/149 - (26%)
Similarity:69/149 - (46%) Gaps:19/149 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 NFKFGETNKSAEFLKKF----PGGKVPAFETAEGQY-LSESNAIAYLLANEQLRGGK-C---PFV 89
            ||:|.:..|.....|.:    |..|:|:.:  :|:: ||||.||.|.|..:...... |   |..
Human    29 NFQFVDLLKGHHHSKGYIDINPLRKLPSLK--DGKFILSESAAILYYLCRKYSAPSHWCPPDPHA 91

  Fly    90 QAQVQQWISFADN--EIVPASCAWVFPLLGILPQQKNSTAKQE--AEAVLQQL----NQKLQDAT 146
            :|:|.:::::...  ::......|:..|:..:..::.|..|.|  .|.|...|    ...|||..
Human    92 RARVDEFVAWQHTAFQLPMKKIVWLKLLIPKITGEEVSAEKMEHAVEEVKNSLQLFEEYFLQDKM 156

  Fly   147 FLAGERITLADIVVFSSLL 165
            |:.|.:|:|||:|....::
Human   157 FITGNQISLADLVAVVEMM 175

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 17/49 (35%)
GstA 5..187 CDD:223698 39/149 (26%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 20/84 (24%)
EF1G 271..376 CDD:279041
GSTT4NP_001345593.1 Thioredoxin_like 3..78 CDD:320948 17/50 (34%)