DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and SPCC1183.02

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_587885.1 Gene:SPCC1183.02 / 2539015 PomBaseID:SPCC1183.02 Length:220 Species:Schizosaccharomyces pombe


Alignment Length:210 Identity:61/210 - (29%)
Similarity:106/210 - (50%) Gaps:19/210 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKGTLYTYPENFRAYKALIAAQYSGAQVKVADNF--KFGETNKSAEFLKKFPGGKVPAFETAEG 63
            |..||||::..|.|....|..|:....||.:.:.:  ||     ||:...|||..|:|.|..|:|
pombe     1 MFLGTLYSFKTNTRTVCLLELAKLLDLQVDLVETYPHKF-----SADLAAKFPLQKLPVFIGADG 60

  Fly    64 QYLSESNAIA---YLLANEQLRGGKCP---FVQAQVQQWISFADNEIV-PASC-AWVFPLLGILP 120
            ..|||..||.   |.......:.|..|   ..:|::.:|:.|.:.:|| |.:. .||....|.:|
pombe    61 FELSEVIAIVKYFYEKGKHNDKEGLGPVNEVEEAEMLKWMCFINFDIVTPQNVRPWVGMFRGNIP 125

  Fly   121 QQKNSTAKQEAEAV--LQQLNQKLQDATFLAGERITLADIVVFSSLLHL-YEYVLEPSVRSAFGN 182
            .::....:....|:  |:..|:.::|.|:|.|:|.||||: .|.|||.: :..:::...|....:
pombe   126 YEEKPFKESATRAIDSLKIPNELVKDRTYLVGDRFTLADL-FFGSLLRIFFNSIIDEKTRKELPH 189

  Fly   183 VNRWFVTILNQKQVQ 197
            :.|:::|:.:|.:::
pombe   190 LTRYYITMFHQAKLE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 28/79 (35%)
GstA 5..187 CDD:223698 57/194 (29%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 30/113 (27%)
EF1G 271..376 CDD:279041
SPCC1183.02NP_587885.1 GST_N_EF1Bgamma 4..76 CDD:239342 28/76 (37%)
GstA 28..198 CDD:223698 51/175 (29%)
GST_C_EF1Bgamma_like 92..217 CDD:198290 30/114 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 43 1.000 Domainoid score I3644
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47299
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43986
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.