DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and gst1

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_588298.1 Gene:gst1 / 2538694 PomBaseID:SPCC191.09c Length:229 Species:Schizosaccharomyces pombe


Alignment Length:242 Identity:54/242 - (22%)
Similarity:89/242 - (36%) Gaps:60/242 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKGTLYTY---PENFRAYKAL--IAAQYSGAQVKVADNFKFGETNKSAEFLKKFPGGKVPA-FE 59
            |.:.||:::   |..::..:||  :...|....|    ||...| .||.|.|...|.|:||. .:
pombe     1 MAQFTLWSHAHGPNPWKVVQALKELDLTYETRYV----NFSKNE-QKSPEHLALNPNGRVPTLID 60

  Fly    60 TAEGQY-LSESNAIAYLLAN---------------EQLRGGKCPFVQAQVQ-------QWISFAD 101
            .....| :.||:||...||:               |..:..:..|.||..|       .|.|...
pombe    61 HHNNDYTIWESDAILIYLADKYDTERKISLPRDHPEYYKVIQYLFFQASGQGIIWGQAGWFSVYH 125

  Fly   102 NEIVPASCAWVFPLLGILPQQKNSTAKQEAEAVLQQLNQKLQDATFLAGERITLADI-------- 158
            .|:|          :..:.:.:|     |.:.||..|...|:|..:|...|.|:||:        
pombe   126 QELV----------ISAITRYRN-----EIKRVLGVLEDILKDRDYLVANRFTIADLSFISWNNF 175

  Fly   159 --VVFS-SLLHLYEYVLEPSVRSAFGNVNRWFVTILNQKQVQAVVKD 202
              ::|: ....:.|.|.:......|.....|...:|.:...:|..::
pombe   176 LEIIFAEGKFSIEEEVPQLDFEKEFPRTYSWHQRLLARPASKATFEE 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 25/96 (26%)
GstA 5..187 CDD:223698 50/221 (23%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 26/131 (20%)
EF1G 271..376 CDD:279041
gst1NP_588298.1 GST_N_Ure2p_like 3..84 CDD:239346 25/85 (29%)
GstA 5..218 CDD:223698 52/232 (22%)
GST_C_Ure2p 96..219 CDD:198326 27/137 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.