Sequence 1: | NP_001189308.1 | Gene: | eEF1gamma / 44791 | FlyBaseID: | FBgn0029176 | Length: | 431 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_491070.1 | Gene: | gst-43 / 190586 | WormBaseID: | WBGene00001791 | Length: | 214 | Species: | Caenorhabditis elegans |
Alignment Length: | 220 | Identity: | 42/220 - (19%) |
---|---|---|---|
Similarity: | 74/220 - (33%) | Gaps: | 78/220 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MVKGTLYTYPENFRAYKALIAAQYSGAQVKVADNFKFGETNK-SAEFLKKFPGGKVPAFETAEGQ 64
Fly 65 YLSESNAIAYLLANEQLRGGKCPFVQAQVQQWISFADNEIVPASCAWVFPLLGILPQQKNSTAKQ 129
Fly 130 EAEAV--------LQQLN-------------------------------QKLQDATFLAGERITL 155
Fly 156 ADI----VVFSSLLHLYEYVLEPSV 176 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
eEF1gamma | NP_001189308.1 | GST_N_EF1Bgamma | 4..79 | CDD:239342 | 23/75 (31%) |
GstA | 5..187 | CDD:223698 | 40/216 (19%) | ||
GST_C_EF1Bgamma_like | 90..209 | CDD:198290 | 17/130 (13%) | ||
EF1G | 271..376 | CDD:279041 | |||
gst-43 | NP_491070.1 | GST_N_Zeta | 4..77 | CDD:239340 | 24/97 (25%) |
maiA | 5..211 | CDD:273527 | 40/216 (19%) | ||
GST_C_Zeta | 90..207 | CDD:198300 | 12/97 (12%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |