powered by:
Protein Alignment eEF1gamma and Y53G8B.1
DIOPT Version :9
Sequence 1: | NP_001189308.1 |
Gene: | eEF1gamma / 44791 |
FlyBaseID: | FBgn0029176 |
Length: | 431 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_497662.1 |
Gene: | Y53G8B.1 / 190243 |
WormBaseID: | WBGene00021817 |
Length: | 213 |
Species: | Caenorhabditis elegans |
Alignment Length: | 166 |
Identity: | 31/166 - (18%) |
Similarity: | 51/166 - (30%) |
Gaps: | 77/166 - (46%) |
- Green bases have known domain annotations that are detailed below.
Fly 42 KSAEFLKKFPGGKVPAFETAEGQYLSESNAIAYLLANEQLRGGKCPFVQAQVQQWISFADNEIVP 106
|..||....|..|||..: ..|..|:||.|| |.:.|.
Worm 42 KEQEFHGNNPAEKVPILK-INGLTLTESMAI------------------------IEYLDE---- 77
Fly 107 ASCAWVFPLLGILPQQKNSTAKQEAEA--------------VLQQLNQK---------------- 141
::|...:||::....|:..|.| :...||:|
Worm 78 -----IYPDPPLLPKEPELKARARAIAFHIASNIQPLQNKPIYLMLNEKEPGYGDFWCQHFISKG 137
Fly 142 ---------LQDATFLAGERITLADI----VVFSSL 164
:....|..|.:|::||| :|::::
Worm 138 FKALEELLQMHSGDFCVGNQISIADICLPSIVYNAI 173
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0625 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.