DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and Y53G8B.1

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_497662.1 Gene:Y53G8B.1 / 190243 WormBaseID:WBGene00021817 Length:213 Species:Caenorhabditis elegans


Alignment Length:166 Identity:31/166 - (18%)
Similarity:51/166 - (30%) Gaps:77/166 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KSAEFLKKFPGGKVPAFETAEGQYLSESNAIAYLLANEQLRGGKCPFVQAQVQQWISFADNEIVP 106
            |..||....|..|||..: ..|..|:||.||                        |.:.|.    
 Worm    42 KEQEFHGNNPAEKVPILK-INGLTLTESMAI------------------------IEYLDE---- 77

  Fly   107 ASCAWVFPLLGILPQQKNSTAKQEAEA--------------VLQQLNQK---------------- 141
                 ::|...:||::....|:..|.|              :...||:|                
 Worm    78 -----IYPDPPLLPKEPELKARARAIAFHIASNIQPLQNKPIYLMLNEKEPGYGDFWCQHFISKG 137

  Fly   142 ---------LQDATFLAGERITLADI----VVFSSL 164
                     :....|..|.:|::|||    :|::::
 Worm   138 FKALEELLQMHSGDFCVGNQISIADICLPSIVYNAI 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 13/36 (36%)
GstA 5..187 CDD:223698 31/166 (19%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 18/118 (15%)
EF1G 271..376 CDD:279041
Y53G8B.1NP_497662.1 Thioredoxin_like 5..76 CDD:294274 14/58 (24%)
maiA 18..211 CDD:273527 31/166 (19%)
GST_C_Zeta 89..207 CDD:198300 13/85 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.