DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and gst-39

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_497119.1 Gene:gst-39 / 190226 WormBaseID:WBGene00001787 Length:209 Species:Caenorhabditis elegans


Alignment Length:160 Identity:46/160 - (28%)
Similarity:68/160 - (42%) Gaps:33/160 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 AQVKVADNFKFGETNKSAEFLK-KFPGGKVPAFETAEGQYLSESNAIAYLLANEQLRGGKCP--- 87
            |.|...|| :....:.|.|.:| |.|.|:||.. :.:|..:.:|.||...|||:....||.|   
 Worm    25 AGVPFEDN-RLTHGDGSWEKIKDKTPFGQVPVL-SVDGFDIPQSAAIIRYLANKFGYAGKTPEEQ 87

  Fly    88 -FVQAQVQQWISFADNEIVPASCAWVFPLLGILPQQKNSTAKQEAE--------------AVLQQ 137
             :..|.|.|:..|..          .|..| |:.|:....|::.|:              .:|..
 Worm    88 AWADAIVDQFKDFMG----------AFRQL-IMAQRSGKPAEEIAKISSEVAIPARDSYFKILNG 141

  Fly   138 LNQKLQDATFLAGERITLADIVVFSSLLHL 167
            |.:|.:.. ||.|:.:|.|||||..:|..|
 Worm   142 LLEKSKSG-FLVGDGLTFADIVVVENLTTL 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 18/52 (35%)
GstA 5..187 CDD:223698 46/160 (29%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 24/92 (26%)
EF1G 271..376 CDD:279041
gst-39NP_497119.1 GST_N_Sigma_like 4..74 CDD:239337 16/50 (32%)
PTZ00057 6..209 CDD:173353 46/160 (29%)
GST_C_Sigma_like 85..191 CDD:198301 24/98 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.