Sequence 1: | NP_001189308.1 | Gene: | eEF1gamma / 44791 | FlyBaseID: | FBgn0029176 | Length: | 431 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_509962.1 | Gene: | gst-42 / 183911 | WormBaseID: | WBGene00001790 | Length: | 214 | Species: | Caenorhabditis elegans |
Alignment Length: | 207 | Identity: | 48/207 - (23%) |
---|---|---|---|
Similarity: | 76/207 - (36%) | Gaps: | 47/207 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KGTLYTYPENFRAYKALIAAQYSGAQVKVADNFKFGETNKSAEFLKKF-PGGKVPAFETAEGQYL 66
Fly 67 SESNAIAYLLANEQLRGG-----KCPFVQAQVQQWISFADNEIVPASCAWVFPLLGILPQQKNST 126
Fly 127 AKQEA------------------EAVLQQLNQKLQDATFLAGERITLADIVVFSSLLHLYEYVLE 173
Fly 174 PSVRSAFGNVNR 185 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
eEF1gamma | NP_001189308.1 | GST_N_EF1Bgamma | 4..79 | CDD:239342 | 22/75 (29%) |
GstA | 5..187 | CDD:223698 | 47/205 (23%) | ||
GST_C_EF1Bgamma_like | 90..209 | CDD:198290 | 22/114 (19%) | ||
EF1G | 271..376 | CDD:279041 | |||
gst-42 | NP_509962.1 | GST_N_Zeta | 6..77 | CDD:239340 | 22/75 (29%) |
maiA | 7..211 | CDD:273527 | 47/205 (23%) | ||
GST_C_Zeta | 90..207 | CDD:198300 | 23/117 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |