DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and gst-42

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_509962.1 Gene:gst-42 / 183911 WormBaseID:WBGene00001790 Length:214 Species:Caenorhabditis elegans


Alignment Length:207 Identity:48/207 - (23%)
Similarity:76/207 - (36%) Gaps:47/207 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KGTLYTYPENFRAYKALIAAQYSGAQVKVADNFKFGETNKSAEFLKKF-PGGKVPAFETAEGQYL 66
            |..||:|..:..:::..||........:........|..||.  ||:. |..|||.| ..:||.:
 Worm     5 KPVLYSYWRSSCSWRVRIALALKNVDYEYKTVDLLSEEAKSK--LKEINPAAKVPTF-VVDGQVI 66

  Fly    67 SESNAIAYLLANEQLRGG-----KCPFVQAQVQQWISFADNEIVPASCAWVFPLLGILPQQKNST 126
            :||.||...|  |:....     |.|..:|..:.......:.|.|.....|..||.         
 Worm    67 TESLAIIEYL--EETHPDVPLLPKDPIKRAHARAISLLVASGIQPLHNLKVLQLLN--------- 120

  Fly   127 AKQEA------------------EAVLQQLNQKLQDATFLAGERITLADIVVFSSLLHLYEYVLE 173
             |:||                  |.:|:|.:.|     :..|:.:|:||:.:...:.....:.|:
 Worm   121 -KKEAGFGGQFAKQFVVEGLTALEILLKQHSGK-----YAVGDDVTIADLSIPPLIYSANRFNLD 179

  Fly   174 PSVRSAFGNVNR 185
               .|.:..|||
 Worm   180 ---LSPYPTVNR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 22/75 (29%)
GstA 5..187 CDD:223698 47/205 (23%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 22/114 (19%)
EF1G 271..376 CDD:279041
gst-42NP_509962.1 GST_N_Zeta 6..77 CDD:239340 22/75 (29%)
maiA 7..211 CDD:273527 47/205 (23%)
GST_C_Zeta 90..207 CDD:198300 23/117 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.