DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and Gstz1

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_034493.1 Gene:Gstz1 / 14874 MGIID:1341859 Length:216 Species:Mus musculus


Alignment Length:208 Identity:44/208 - (21%)
Similarity:81/208 - (38%) Gaps:46/208 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KGTLYTYPENFRAYKALIAAQYSGAQVKVA--DNFKFGETNKSAEFLKKFPGGKVPAFE------ 59
            |..||:|..:..:::..||....|...::.  :..|.|....:.||....|..:|||.:      
Mouse     5 KPILYSYFRSSCSWRVRIALALKGIDYEIVPINLIKDGGQQFTEEFQTLNPMKQVPALKIDGITI 69

  Fly    60 ---TAEGQYLSESNAIAYLLANEQLRGGKCPFVQAQVQQWISFADNEIVPASCAWVFPLLGILPQ 121
               .|..:||.|:..|..||..:       |..:|.|:. ||    :::.:         ||.|.
Mouse    70 VQSLAIMEYLEETRPIPRLLPQD-------PQKRAIVRM-IS----DLIAS---------GIQPL 113

  Fly   122 QKNSTAKQEAEAVLQQLNQKLQDATFLA--------------GERITLADIVVFSSLLHLYEYVL 172
            |..|..||..:....|..||:..:.|.|              |:.:::||:.:...:.:...:.:
Mouse   114 QNLSVLKQVGQENQMQWAQKVITSGFNALEKILQSTAGKYCVGDEVSMADVCLVPQVANAERFKV 178

  Fly   173 EPSVRSAFGNVNR 185
            :.|......::|:
Mouse   179 DLSPYPTISHINK 191

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 21/85 (25%)
GstA 5..187 CDD:223698 43/206 (21%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 21/110 (19%)
EF1G 271..376 CDD:279041
Gstz1NP_034493.1 GST_N_Zeta 6..80 CDD:239340 16/73 (22%)
maiA 7..211 CDD:273527 43/206 (21%)
Glutathione binding 14..19 0/4 (0%)