DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and GSTE2

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_319968.3 Gene:GSTE2 / 1280155 VectorBaseID:AGAP009194 Length:221 Species:Anopheles gambiae


Alignment Length:149 Identity:38/149 - (25%)
Similarity:67/149 - (44%) Gaps:14/149 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EFLKKFPGGKVPAFETAEGQYLSESNAIAYLLANEQLRGG----KCPFVQAQVQQWISFADNEIV 105
            ||:|..|...:|..:. .|..::||:||...|..:..:..    |.|..||:|...:.| ::.::
Mosquito    45 EFVKLNPQHTIPVLDD-NGTIITESHAIMIYLVTKYGKDDSLYPKDPVKQARVNSALHF-ESGVL 107

  Fly   106 PASCAWVFPLLGILPQQKNSTAKQEAEAVLQQLNQKLQDA---TFLAGERITLADIVVFSSLLHL 167
            .|...::|.  .||...|:...:...|.| |:..:.|:|.   .|:||..:|:||....|::..:
Mosquito   108 FARMRFIFE--RILFFGKSDIPEDRVEYV-QKSYELLEDTLVDDFVAGPTMTIADFSCISTISSI 169

  Fly   168 YEYVLEPSVRSAFGNVNRW 186
            ...|  |..:|....:..|
Mosquito   170 MGVV--PLEQSKHPRIYAW 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 11/33 (33%)
GstA 5..187 CDD:223698 38/149 (26%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 25/100 (25%)
EF1G 271..376 CDD:279041
GSTE2XP_319968.3 GstA 4..194 CDD:223698 38/149 (26%)
GST_N_Delta_Epsilon 4..76 CDD:239343 10/31 (32%)
GST_C_Delta_Epsilon 91..208 CDD:198287 25/102 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.