DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and GSTE4

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_319967.1 Gene:GSTE4 / 1280154 VectorBaseID:AGAP009193 Length:225 Species:Anopheles gambiae


Alignment Length:176 Identity:37/176 - (21%)
Similarity:71/176 - (40%) Gaps:25/176 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NFRAYKALIA---------AQYSGAQVKVADNFKFGETNKSAEFLKKFPGGKVPAFETAEGQYLS 67
            |.:.|.|.::         |:..|.::.:.......:.:.:..|.|..|...:|..:. .|..:.
Mosquito     3 NIKLYTAKLSPPGRSVELTAKALGLELDIVPINLLAQEHLTEAFRKLNPQHTIPLIDD-NGTIVW 66

  Fly    68 ESNAI-AYLLANEQLRGGKCPF----VQ-AQVQQWISFADNEIVPASCAWVFPLLGI----LPQQ 122
            :|:|| .||::......|...:    || |:|...:.|....:......::.|:|..    .||:
Mosquito    67 DSHAINVYLVSKYGKPEGDSLYPSDVVQRAKVNAALHFDSGVLFARFRFYLEPILYYGATETPQE 131

  Fly   123 KNSTAKQEAEAVLQQLNQKLQDATFLAGERITLADIVVFSSLLHLY 168
            |.....:..|.    ||..|.| .::.|..:||||:...:|:..::
Mosquito   132 KIDNLYRAYEL----LNDTLVD-EYIVGNEMTLADLSCIASIASMH 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 15/76 (20%)
GstA 5..187 CDD:223698 37/176 (21%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 20/84 (24%)
EF1G 271..376 CDD:279041
GSTE4XP_319967.1 GstA 4..211 CDD:223698 36/175 (21%)
GST_N_Delta_Epsilon 4..77 CDD:239343 14/73 (19%)
GST_C_Delta_Epsilon 93..210 CDD:198287 21/85 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.