DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and GSTT2

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_003437127.1 Gene:GSTT2 / 1277405 VectorBaseID:AGAP000888 Length:235 Species:Anopheles gambiae


Alignment Length:122 Identity:39/122 - (31%)
Similarity:58/122 - (47%) Gaps:19/122 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GKVPAFETAEGQY-LSESNAIAYLLANEQLRGG----KCPFVQAQVQQWISF------ADNEIVP 106
            ||||..  .:|.: |:||.||...|..|....|    .....||:|.:::|:      ||..:. 
Mosquito    55 GKVPCI--VDGSFRLAESVAIYRYLCREFPTDGHWYPSDTVRQARVDEYLSWQHLNLRADVSLY- 116

  Fly   107 ASCAWVFPLLGILPQQ-KNSTAKQEAEAVLQQLNQKLQDA----TFLAGERITLADI 158
            ....|:.||||..|.. |....::..:.||...:|:|..|    .||||:||::||:
Mosquito   117 FFHVWLNPLLGKEPDAGKTERLRRRLDGVLNFFDQELLSAGSGQAFLAGDRISIADL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 11/26 (42%)
GstA 5..187 CDD:223698 39/122 (32%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 26/80 (33%)
EF1G 271..376 CDD:279041
GSTT2XP_003437127.1 GST_N_Theta 5..81 CDD:239348 11/27 (41%)
GstA 6..206 CDD:223698 39/122 (32%)
GST_C_Theta 94..221 CDD:198292 26/81 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.