DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and AgaP_AGAP004929

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_315016.4 Gene:AgaP_AGAP004929 / 1275730 VectorBaseID:AGAP004929 Length:180 Species:Anopheles gambiae


Alignment Length:161 Identity:44/161 - (27%)
Similarity:76/161 - (47%) Gaps:32/161 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 TNKSAEFLKKFPGGKV--------PAFETAEGQYLSESNAIAYLLANE----QLRGGKCPF-VQA 91
            |.:.|.|| :.|.|||        ...::|:...:|..::|...|..|    .:|.....| .:.
Mosquito     7 TKRIATFL-EVPLGKVGYNAEKILTRTKSAQEPSISGFSSIIQSLIRESKKSSVRQAHSDFETEC 70

  Fly    92 QVQQWISFADNEIVPASCAWVFPLLGILPQQKNSTAKQEAEAVLQQLNQKLQDATFLAGERITLA 156
            |:.||:.:|              :|.:.|..|:   |..|:::|.:||..||..::|..:.:::|
Mosquito    71 QILQWLDYA--------------VLFVAPSNKD---KHTAKSLLDELNFYLQSRSYLVNDTLSVA 118

  Fly   157 DIVVFSSLLHLYEYVLEPSVRSAFGNVNRWF 187
            |:|||.: :|.....|:|..:..|.||:|||
Mosquito   119 DVVVFHT-IHETMANLQPLEKENFLNVSRWF 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 12/46 (26%)
GstA 5..187 CDD:223698 42/159 (26%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 29/98 (30%)
EF1G 271..376 CDD:279041
AgaP_AGAP004929XP_315016.4 GST_C_AIMP3 66..167 CDD:198338 30/101 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.