DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and GSTD10

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_313668.1 Gene:GSTD10 / 1274530 VectorBaseID:AGAP004383 Length:211 Species:Anopheles gambiae


Alignment Length:202 Identity:49/202 - (24%)
Similarity:89/202 - (44%) Gaps:34/202 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KVADNFKFGETN----KSAEFLKKF-PGGKVPAFETAEGQYLSESNAIAYLLANEQLRGG----- 84
            |:...|...|.|    :..|.|:|| |...:|.| ..:|..:.||.|||..|..:...|.     
Mosquito    21 KLGITFDLKEVNPHLPEVREQLRKFNPQHTIPTF-IEDGHVIWESYAIAIYLVEKYGNGDDALYP 84

  Fly    85 KCPFVQAQVQQWISFADNEIVPASCAWVFPLL--GILPQQKNSTAKQEAEAVLQQLNQKLQDATF 147
            :.|.|::.|.|.:.|.:..:..::..:|..:|  .:.|.::   .:|..:..|..|...:::..|
Mosquito    85 RDPKVRSVVNQRLFFDNGLMFKSAIEYVECILKKKLEPTEE---MQQRLKKALGLLESFVKERAF 146

  Fly   148 LAGERITLADIVVFSS--LLHLYEYVLEPSVRSAFGNVNRWFVTILNQKQVQAVVKDY-----KL 205
            :|.:.:|:|||.:.||  ||...:|.|     :.|..:..|...:..:      :.||     :|
Mosquito   147 VASDHLTIADICLLSSVTLLTGIKYDL-----ATFPGITAWVARVTGE------LPDYGEFHKEL 200

  Fly   206 CEKALVF 212
            .||::.:
Mosquito   201 YEKSMEY 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 18/53 (34%)
GstA 5..187 CDD:223698 43/170 (25%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 27/127 (21%)
EF1G 271..376 CDD:279041
GSTD10XP_313668.1 GstA 1..186 CDD:223698 44/173 (25%)
GST_N_Delta_Epsilon 1..73 CDD:239343 18/52 (35%)
GST_C_Delta_Epsilon 88..200 CDD:198287 26/125 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.