DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and GSTT2_ANOGA

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_313052.1 Gene:GSTT2_ANOGA / 1273989 VectorBaseID:AGAP004165 Length:209 Species:Anopheles gambiae


Alignment Length:187 Identity:48/187 - (25%)
Similarity:82/187 - (43%) Gaps:28/187 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AAQYSGAQVKVADNFKF----GETNKSAEFLKKFPGGKVPAFETAEGQ-YLSESNAIAYLLANEQ 80
            |.|.....|.|..|.|:    ...::|.:|.|..|...:|..  .:|. .||||.|....|.::.
Mosquito    15 AVQMVAEAVHVKLNLKYLDLMAGAHRSPQFTKLNPQRTIPTL--VDGSLILSESRAALIYLCDQY 77

  Fly    81 LRGG-------KCPFVQAQVQQWISFADNEIVPASCAWVFPLL--GILPQQKNSTAKQEAEAVLQ 136
              |.       :....:|.|.|.:.|....:.|....:..|.:  ...|..:...|.::|   ::
Mosquito    78 --GDEDNDWYPRDTIQRAIVNQRLFFDACVLYPRFADFYHPQVFGNAAPDGRKRLAFEKA---VE 137

  Fly   137 QLNQKLQDATFLAGERITLADIVVFSSLLH--LYEYVLEPSVRSAFGNVNRWFVTIL 191
            .||..|.:..|:||.::|:|||.:|::|..  ...::|.|.|     :|:||:||::
Mosquito   138 LLNIFLSEHEFVAGSKMTIADISLFATLATACTLGFILRPYV-----HVDRWYVTMV 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 18/62 (29%)
GstA 5..187 CDD:223698 45/181 (25%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 29/106 (27%)
EF1G 271..376 CDD:279041
GSTT2_ANOGAXP_313052.1 GST_N_Delta_Epsilon 2..75 CDD:239343 18/61 (30%)
GstA 4..190 CDD:223698 48/187 (26%)
GST_C_Delta_Epsilon 91..205 CDD:198287 29/107 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.