DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and GSTZ1

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_003436289.1 Gene:GSTZ1 / 1273066 VectorBaseID:AGAP002898 Length:263 Species:Anopheles gambiae


Alignment Length:214 Identity:49/214 - (22%)
Similarity:81/214 - (37%) Gaps:49/214 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKGTLYTYPENFRAYKALIAAQYSGA--QVKVADNFKFGETNKSAEFLKKFPGGKVPAFETAEG 63
            |.|..||:|..:..:::..||......  .:|.....|.|......|:.:..|..:|||.: .:|
Mosquito    50 MSKPILYSYWRSSCSWRVRIALNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQ-IDG 113

  Fly    64 QYLSESNAIAY----------LLANEQLRGGK----CPFVQAQVQQWISFADNEIVPASCAWVFP 114
            ..|.||.:|.|          |:..:.|:..|    |..:.:.||.    ..|.||         
Mosquito   114 HTLIESVSIMYYLEETRPQRPLMPQDVLKRAKVREICEVIASGVQP----LQNLIV--------- 165

  Fly   115 LLGILPQQKNSTAKQEAEAVLQQLNQKLQDAT--FLAGERITLADIV----VFSSL-----LHLY 168
            |:.:..::|...|:.......:.:.:.|..:.  |..|:.|||||..    ||::.     |..|
Mosquito   166 LIHVGEEKKKEWAQHWITRGFRAIEKLLSTSAGKFCVGDEITLADCCLVPQVFNARRFHVDLRPY 230

  Fly   169 EYVL--------EPSVRSA 179
            ..:|        .|:.|:|
Mosquito   231 PIILRIDRELEGHPAFRAA 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 20/86 (23%)
GstA 5..187 CDD:223698 47/210 (22%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 24/109 (22%)
EF1G 271..376 CDD:279041
GSTZ1XP_003436289.1 GST_N_Zeta 53..127 CDD:239340 19/74 (26%)
maiA 54..258 CDD:273527 47/210 (22%)
GST_C_Zeta 142..254 CDD:198300 26/121 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.