DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and GSTU1

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_309135.1 Gene:GSTU1 / 1270441 VectorBaseID:AGAP000947 Length:233 Species:Anopheles gambiae


Alignment Length:208 Identity:51/208 - (24%)
Similarity:83/208 - (39%) Gaps:45/208 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SAEFLKKFPGGKVPAFETAEGQYLSESNAIAYLLANEQLRGGKC----PFVQAQVQQWISFADNE 103
            :||:.|..|..::|..:. :|.:|||||||...|..:.......    |..:|.|...:.|....
Mosquito    40 TAEYEKMNPQKEIPVLDD-DGFFLSESNAILQYLCEKYAPTSDLYPNDPKDRALVNHRLCFNLAF 103

  Fly   104 IVPASCAWVF-PL--------LGILPQQKNSTAKQEAEAVLQQLNQKLQDATFLAGERITLADIV 159
            :.|...|:|. |:        :|:   :|...|....|..||:...:     :.||..:|:||..
Mosquito   104 LYPQISAYVMAPIFFDYERTAIGL---KKLHLALAAFETYLQRTGTR-----YAAGSGLTIADFP 160

  Fly   160 VFSSLLHLYEYVLEPSVRSAFGNVNRWFVTILNQKQVQAVVKDYKLCEKAL----VFDPKKYAEF 220
            :.||::.| |.:       .||...|:       .:|||....:|....:|    ....::.|||
Mosquito   161 LVSSVMCL-EAI-------GFGLGERY-------PKVQAWYDGFKQAHPSLWAIAAKGMEEIAEF 210

  Fly   221 QAK----TGAAKP 229
            :..    ||...|
Mosquito   211 EKNPPDLTGMVHP 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 14/35 (40%)
GstA 5..187 CDD:223698 40/156 (26%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 29/127 (23%)
EF1G 271..376 CDD:279041
GSTU1XP_309135.1 GstA 1..208 CDD:223698 45/191 (24%)
Thioredoxin_like 1..72 CDD:294274 13/32 (41%)
GST_C_Delta_Epsilon 88..208 CDD:198287 30/142 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.