DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and gstz1

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_002938913.1 Gene:gstz1 / 100145591 XenbaseID:XB-GENE-978910 Length:216 Species:Xenopus tropicalis


Alignment Length:214 Identity:48/214 - (22%)
Similarity:87/214 - (40%) Gaps:21/214 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KGTLYTYPENFRAYKALIAAQYSGAQV--KVADNFKFGETNKSAEFLKKFPGGKVPAFETAEGQY 65
            |..||.|..:..:::..||..:.|.:.  :|.:..|.|....|.|:.:..|..:|||. ..:|..
 Frog     6 KPLLYGYFRSSCSWRVRIALAFKGIEYDQQVINLVKDGGMQLSNEYKQVNPMQQVPAL-CIDGVT 69

  Fly    66 LSESNAIAYLLANEQLRGG-----KCPFVQAQVQQWISFADNEIVPASCAWVFPLLGILPQQKNS 125
            ||:|.||...|  |:.|..     :.|..:|||:.......:.|.|.....|...:|   :.|..
 Frog    70 LSQSLAIIEYL--EETRPNPPLLPRDPKKRAQVRMISDQIASGIQPLQNLCVLQKIG---ETKLE 129

  Fly   126 TAKQEAEAVLQQLNQKLQDAT--FLAGERITLADIVVFSSLLHLYEYVLEPSVRSAFGNVNRWFV 188
            .||.......|.|.:.||...  :..|:.:|:||:.:...:.:...:.::.:.......:|...:
 Frog   130 WAKHFITRGFQALEKLLQTTAGRYCVGDEVTIADLCLVPQVANAVRFKVDLAPYPTIVGINESLL 194

  Fly   189 TILNQKQVQAVVKDYKLCE 207
                  |::|....:..|:
 Frog   195 ------QLEAFQVSHPSCQ 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 22/76 (29%)
GstA 5..187 CDD:223698 44/190 (23%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 22/120 (18%)
EF1G 271..376 CDD:279041
gstz1XP_002938913.1 maiA 8..211 CDD:273527 47/212 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.