powered by:
Protein Alignment TwdlT and CG34305
DIOPT Version :9
Sequence 1: | NP_651999.1 |
Gene: | TwdlT / 44790 |
FlyBaseID: | FBgn0029170 |
Length: | 286 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001097671.1 |
Gene: | CG34305 / 5740825 |
FlyBaseID: | FBgn0085334 |
Length: | 79 |
Species: | Drosophila melanogaster |
Alignment Length: | 48 |
Identity: | 13/48 - (27%) |
Similarity: | 21/48 - (43%) |
Gaps: | 3/48 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 205 IVIPTPAPTQPSKPEVYFIKYKTQKDSSGISGGISGS---TGGFTQTN 249
|.:..||....:.|.|..::||..:|.:.|...|... .||.|:.:
Fly 15 IALSAPAAATDNAPTVSVLRYKDDRDLANIQRAIIAQYERIGGTTKVH 62
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
TwdlT | NP_651999.1 |
DUF243 |
132..225 |
CDD:281144 |
5/19 (26%) |
CG34305 | NP_001097671.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000952 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.