DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlT and TwdlD

DIOPT Version :9

Sequence 1:NP_651999.1 Gene:TwdlT / 44790 FlyBaseID:FBgn0029170 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_651492.1 Gene:TwdlD / 43210 FlyBaseID:FBgn0039444 Length:256 Species:Drosophila melanogaster


Alignment Length:171 Identity:44/171 - (25%)
Similarity:75/171 - (43%) Gaps:37/171 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 QKHIYVHVPPPEQEEVRQRPNLPIGQS-QKHYKIIFIKAPSPPSYQAPVIPLQPQN-EEKTLVYV 194
            ||..|.:..|.||.: ....|..|..| :|:.:::||:.|....::...:.|..|: :::|.:||
  Fly    80 QKEFYSYAAPEEQYD-EGASNQQIANSLKKNLRVVFIRTPENQGFERAALQLAKQSAQQETAIYV 143

  Fly   195 LVKKPEDQQDI--------VIPTPAPTQPSKPEVYFIKYKTQKDSSGISGGISGSTGGFTQTNTG 251
            |.|    |.|:        .:.|   :..:||||:|:||:|.:|::.....|.      .|.|..
  Fly   144 LTK----QSDVSNLAKQLNALKT---SSTNKPEVHFVKYRTPEDAANAQLAIQ------NQYNQL 195

  Fly   252 NGYTSGGDGG------FTGGDSG-------SISAPSSNYGP 279
            .|.:...:.|      |....:.       :.:||||.|.|
  Fly   196 PGVSRISNEGRAPVLNFASSPAQAAAIPAVAAAAPSSEYLP 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlTNP_651999.1 DUF243 132..225 CDD:281144 28/102 (27%)
TwdlDNP_651492.1 DM5 78..178 CDD:214776 30/105 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450400
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.