DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlT and TwdlN

DIOPT Version :9

Sequence 1:NP_651999.1 Gene:TwdlT / 44790 FlyBaseID:FBgn0029170 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_733160.1 Gene:TwdlN / 43207 FlyBaseID:FBgn0039441 Length:309 Species:Drosophila melanogaster


Alignment Length:289 Identity:92/289 - (31%)
Similarity:122/289 - (42%) Gaps:38/289 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFILMSCLALAAARPEAGYNYN-----------RPGGGGGSGGGSGG--GLGGGFGGGSSGGF 52
            |:||::: ||...|:..:.||||.           .||.|..|.||.||  ||||..|....||.
  Fly     1 MRAFVVL-CLVAIASADKLGYNYKPVGHSSSGLSFAPGSGSLSLGGGGGSLGLGGSSGSLDLGGA 64

  Fly    53 GGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGG 117
            .|.:  |.|||...||..|||...|||....|..|.|..|.|.|. |.||.|||.|..|.||  |
  Fly    65 SGSL--GLGGGSNFGSLDGGFGGLGGGSIDLGSSGLGSSGLGSGL-GSSGLGSGLGSSGLGS--G 124

  Fly   118 FGGGG-------GGGGGTTLVQKHIYVHVPPPEQEEVRQRPNLPIGQSQKHYKIIFIKAPSPPSY 175
            .|..|       ........:||..:.:....|..:..|..........|..:::|||.|.....
  Fly   125 LGSAGLSAPVSYNAPAPAAELQKEFFTYTANEEDFDEPQALERVASSVNKGLRVVFIKGPENRGL 189

  Fly   176 QAPVIPLQPQ-NEEKTLVYVLVKKPEDQQDIVIPTPA--PTQPSKPEVYFIKYKTQKDSSGISGG 237
            :...:.|..| .:::|.:||| .|..|..|:.....|  ....:||||:|:||:|.:|::.....
  Fly   190 ENAALALAKQAAQQETAIYVL-NKQADIGDLAQKLNAIRSNSNNKPEVHFVKYRTPEDAANAQRA 253

  Fly   238 ISG---STGGFTQTNTGN-----GYTSGG 258
            |..   ..||.:|...|.     .:.|.|
  Fly   254 IQSQYDQLGGSSQAINGGVANALNFASAG 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlTNP_651999.1 DUF243 132..225 CDD:281144 24/95 (25%)
TwdlNNP_733160.1 DM5 143..244 CDD:214776 26/101 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450395
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.