DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlT and TwdlJ

DIOPT Version :9

Sequence 1:NP_651999.1 Gene:TwdlT / 44790 FlyBaseID:FBgn0029170 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_651489.2 Gene:TwdlJ / 43206 FlyBaseID:FBgn0039440 Length:274 Species:Drosophila melanogaster


Alignment Length:321 Identity:65/321 - (20%)
Similarity:101/321 - (31%) Gaps:98/321 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAF--ILMSCLALAAARPEAGYNY----NRPGGGGGSGGGSGGGLGGGFGGGSSGGFGGG---I 56
            |:.|  :|..|||:.|...:.||||    :.|.|......||.......|....|..||.|   |
  Fly     1 MRQFSVVLCLCLAVLARADKLGYNYQPVAHSPSGLSFQPSGSASSDAPAFAPAPSESFGPGPSSI 65

  Fly    57 GGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGFGGG 121
            .....|.          .|.....:::                                      
  Fly    66 ADALEGS----------QSAAAPNYAA-------------------------------------- 82

  Fly   122 GGGGGGTTLVQKHIYVHV-------PPPEQEEVRQRPNLPIGQSQKHYKIIFIKAPSPPSYQAPV 179
                 ....::|..:.:.       .|...:.|....|       |..:::|||.|.....:...
  Fly    83 -----PQAQLEKEFFTYTADEGDFYDPAASDRVANAVN-------KGLRVVFIKGPENRGLEDAA 135

  Fly   180 IPLQPQ-NEEKTLVYVLVKKPEDQQDIV--IPTPAPTQPSKPEVYFIKYKTQKDSSGISGGISG- 240
            :.|..| .:::|.:||| .|..|..|:.  :.:......:||||:|:||:|.:|::.....|.| 
  Fly   136 LALAKQAAQQETAIYVL-NKQADIGDLANKLNSIRNNNNNKPEVHFVKYRTPEDAANAQSAIQGQ 199

  Fly   241 --STGGFTQTNTG---------------NGYTSGGDGGFTGGDSGSISAPSSNYGPPGKSG 284
              ..||.:|...|               ...:|.....|........:||.|:|.||...|
  Fly   200 YDQLGGSSQAQDGGVASTLNFASQPAPVQAASSQAPAQFLPASQPEATAPISSYVPPATPG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlTNP_651999.1 DUF243 132..225 CDD:281144 23/102 (23%)
TwdlJNP_651489.2 DM5 85..186 CDD:214776 25/108 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450391
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.