DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlT and TwdlW

DIOPT Version :9

Sequence 1:NP_651999.1 Gene:TwdlT / 44790 FlyBaseID:FBgn0029170 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_650606.2 Gene:TwdlW / 42075 FlyBaseID:FBgn0038487 Length:308 Species:Drosophila melanogaster


Alignment Length:155 Identity:48/155 - (30%)
Similarity:74/155 - (47%) Gaps:18/155 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 LVQKHIYVHVPPPEQE-EVRQRPNLPIGQSQKHYKIIFIKAPSPPSYQAPVIPLQPQNEEKTLVY 193
            :|.|:.::|..|.|.| ||:...|....|.:.||.::|:|.|:..:..|.:...:...:|||:||
  Fly   128 IVTKNFFIHSAPEESEDEVQDELNQLAQQPRNHYNVLFVKTPAQTNRAAALNLAKTLKQEKTVVY 192

  Fly   194 VLVKK--PEDQQDIVIPTPAPTQPSKPEVYFIKYKTQKDSSGISGGISGSTGGFTQTNTGNGY-T 255
            ||.||  ..|.||.:  ..||...:||||:||||:|.:::..            .|....:.| |
  Fly   193 VLAKKTTASDLQDAI--AEAPQHINKPEVFFIKYRTPEEALN------------AQRQIQSQYDT 243

  Fly   256 SGGDGGFTGGDSGSISAPSSNYGPP 280
            .||....|......|::...:..||
  Fly   244 LGGSSTITDEGVAPITSVVGSLDPP 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlTNP_651999.1 DUF243 132..225 CDD:281144 35/95 (37%)
TwdlWNP_650606.2 DM5 127..227 CDD:214776 38/100 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450386
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.