DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlT and TwdlF

DIOPT Version :9

Sequence 1:NP_651999.1 Gene:TwdlT / 44790 FlyBaseID:FBgn0029170 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_649443.1 Gene:TwdlF / 40534 FlyBaseID:FBgn0037224 Length:354 Species:Drosophila melanogaster


Alignment Length:158 Identity:65/158 - (41%)
Similarity:86/158 - (54%) Gaps:21/158 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 LVQKHIYVHVPPPEQEEVRQ-RP---NLPIGQSQKHYKIIFIKAPSPP-SYQAPVIP-LQPQNEE 188
            :|.|.||:|..|.|.||:|| .|   |:||   :|:|:|:||||||.. .|.|..:. .|..|||
  Fly   138 IVTKDIYIHSAPEENEELRQDEPLLENVPI---RKNYRIVFIKAPSQNLKYTAAALKRAQSSNEE 199

  Fly   189 KTLVYVLVKKP---EDQQDIVIPTPAPTQPSKPEVYFIKYKTQKDSSGISGGISGSTGGFTQTNT 250
            ||::|||.|||   |.||.:.: |.:..:..||||||||||||:::......|.      .|.:.
  Fly   200 KTVIYVLSKKPDLTEIQQQLQV-TQSEAKVQKPEVYFIKYKTQEEAQRAQQEIQ------AQYDA 257

  Fly   251 GNGYTSGGDGGFTGGDSGSISAPSSNYG 278
            ..|.|...|.|.  ....|:|:.|.|.|
  Fly   258 LGGATHISDEGV--APIASVSSGSLNLG 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlTNP_651999.1 DUF243 132..225 CDD:281144 48/101 (48%)
TwdlFNP_649443.1 DM5 137..241 CDD:214776 52/106 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450388
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.