DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlT and TwdlX

DIOPT Version :9

Sequence 1:NP_651999.1 Gene:TwdlT / 44790 FlyBaseID:FBgn0029170 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_728016.1 Gene:TwdlX / 318094 FlyBaseID:FBgn0052571 Length:346 Species:Drosophila melanogaster


Alignment Length:338 Identity:88/338 - (26%)
Similarity:138/338 - (40%) Gaps:80/338 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFILMSCLA-----LAAARPE----AGYNYNRPGGGGGSGGGSGGGLGGGFGGGSSGGFGGGI 56
            ||.|::::.||     |||.||:    |||:|                        .:||:.|.:
  Fly     1 MKQFVVLAVLAVIGGSLAAPRPDVSHLAGYSY------------------------QAGGYNGNL 41

  Fly    57 GGG---------FGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGGS---GGGF 109
            ...         ....:...:.|..:.|..........|..|..|......||||..|   |...
  Fly    42 VANQVLSAPLTTVTTSYQPTAAGTNYYSSAPSIGQLNLGSSGSSGVVNYQVGGSGSSSYQVGSSS 106

  Fly   110 GGGGSIGGFGGGGGGGGGTTL-------------------VQKHIYVHVPPPEQEEVRQRPNLPI 155
            .|||.:....|..|...|.|:                   :.||.|:|..|.:.:|.:....:.:
  Fly   107 VGGGIVNDNIGLAGLQPGPTINYNEQESYISHLANFQPAQINKHFYIHSAPEDHDEQQIVRYVNV 171

  Fly   156 GQSQKHYKIIFIKAPSPPSYQAPVIPLQPQNEEKTLVYVLVKKPEDQQDIV--IPTPAPTQPSKP 218
            |:.||:|:::||.||:..:.:|.:|......||||.:|||.|| .:..|:.  :.|..|. .:||
  Fly   172 GRPQKNYRVVFINAPTSTASKAKIIANVAPVEEKTAIYVLSKK-SNALDVTAEVVTQRPV-ANKP 234

  Fly   219 EVYFIKYKTQKDSSGISGGISG---STGGFTQT-NTG-----NGYTSGGDGGFTG---GDSGSIS 271
            ||:|:||||.::::.....|..   :.||.::| |.|     :...|.||.|.:|   ..|||::
  Fly   235 EVFFVKYKTPQEAAHAQQTIQANYDALGGSSETSNEGVIPVSSVIGSLGDNGASGVLTDASGSVN 299

  Fly   272 APSSNYGPPGKSG 284
            ...:...|...:|
  Fly   300 IVGTGGVPTVDAG 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlTNP_651999.1 DUF243 132..225 CDD:281144 33/94 (35%)
TwdlXNP_728016.1 DUF243 148..241 CDD:281144 33/94 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450384
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.