DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment miple2 and mdk

DIOPT Version :9

Sequence 1:NP_001261198.1 Gene:miple2 / 44787 FlyBaseID:FBgn0029002 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_989074.1 Gene:mdk / 394671 XenbaseID:XB-GENE-488502 Length:142 Species:Xenopus tropicalis


Alignment Length:135 Identity:32/135 - (23%)
Similarity:50/135 - (37%) Gaps:36/135 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 ALSSQLPQPNHKQGHKNT-------------DKQQRGGGSKQQRGHSQHHGGNRKGPKAATPEN- 155
            |:|||..:...::|.|..             :.:..|.|:::.....:    .|| .|...|.| 
 Frog    16 AVSSQAAKNKKEKGKKGASDCTEWTWGRCIPNSKDCGAGTREGTCKEE----TRK-LKCKIPCNW 75

  Fly   156 ----GSTCRYAKSAWSNCDHKTNMRSRVLSLRKGEQN--CLPTRTIQKKC-------KKGARGCR 207
                |:.|:|....|..|:..|..:.|..:|:|...|  |..|....|.|       .||.:|  
 Frog    76 KKAFGADCKYKFENWGECNATTGQKVRSGTLKKALYNADCQQTVEATKPCSLKTKSKSKGKKG-- 138

  Fly   208 YEKGE 212
              ||:
 Frog   139 --KGK 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
miple2NP_001261198.1 PTN_MK_C 156..201 CDD:279437 14/53 (26%)
PTN_MK_C 205..255 CDD:279437 3/8 (38%)
mdkNP_989074.1 PTN 36..115 CDD:128490 17/83 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1489280at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.