DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment miple2 and miple1

DIOPT Version :9

Sequence 1:NP_001261198.1 Gene:miple2 / 44787 FlyBaseID:FBgn0029002 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001261197.1 Gene:miple1 / 38047 FlyBaseID:FBgn0027111 Length:185 Species:Drosophila melanogaster


Alignment Length:134 Identity:63/134 - (47%)
Similarity:82/134 - (61%) Gaps:18/134 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 NRKGPKAATPENGSTCRYAKSAWSNCDHKTNMRSRVLSLRKGEQNCLPTRTIQKKCKKGARGCRY 208
            |.:|.|:    :|.:|||.|:.|:.||.|||.|||.|:|:||:..|..||||||||||   .|||
  Fly    65 NERGTKS----DGLSCRYGKNPWTECDTKTNTRSRTLTLKKGDPACDQTRTIQKKCKK---ACRY 122

  Fly   209 EKGEWSQCVGGQITREDKLEPEATGGSDQNCNPVRTVSKKCKANGNSSGGKQHGQSRRTKEQKQK 273
            |||.||:|..||:||.|||:    ..||.:|...|.:.|.||.      ||...:|.: :::|.|
  Fly   123 EKGSWSECATGQMTRADKLK----ASSDPSCEATRVIKKNCKP------GKSKDKSAK-EQRKNK 176

  Fly   274 DKGA 277
            ||.|
  Fly   177 DKAA 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
miple2NP_001261198.1 PTN_MK_C 156..201 CDD:279437 27/44 (61%)
PTN_MK_C 205..255 CDD:279437 23/49 (47%)
miple1NP_001261197.1 PTN_MK_C 73..124 CDD:395867 32/53 (60%)
PTN_MK_C 119..176 CDD:395867 27/67 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466847
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2D544
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1489280at2759
OrthoFinder 1 1.000 - - FOG0014410
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.