DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment miple2 and Ptn

DIOPT Version :9

Sequence 1:NP_001261198.1 Gene:miple2 / 44787 FlyBaseID:FBgn0029002 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_006505820.3 Gene:Ptn / 19242 MGIID:97804 Length:183 Species:Mus musculus


Alignment Length:121 Identity:31/121 - (25%)
Similarity:44/121 - (36%) Gaps:50/121 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 GSTCRYAKSAWSNCDHKTNMRSRVLSLRKGEQN--CLPTRTIQKKCKKGARGCRYEKGEWSQCVG 218
            |:.|:|...||..||..|.:::|..||::...|  |..|.||.|.|                   
Mouse   111 GAECKYQFQAWGECDLNTALKTRTGSLKRALHNADCQKTVTISKPC------------------- 156

  Fly   219 GQITREDKLEPEATGGSDQNCNPVRTVSKKCKANGNSSGGKQHGQSRRTKEQKQKD 274
            |::|   |.:|:|.             |||.|..|.             |::|..|
Mouse   157 GKLT---KPKPQAE-------------SKKKKKEGK-------------KQEKMLD 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
miple2NP_001261198.1 PTN_MK_C 156..201 CDD:279437 18/46 (39%)
PTN_MK_C 205..255 CDD:279437 10/49 (20%)
PtnXP_006505820.3 PTN_MK_N 62..146 CDD:382992 12/34 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1489280at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.