DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37A and RPL43B

DIOPT Version :9

Sequence 1:NP_001188691.1 Gene:RpL37A / 44783 FlyBaseID:FBgn0261608 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_012628.3 Gene:RPL43B / 853557 SGDID:S000003855 Length:92 Species:Saccharomyces cerevisiae


Alignment Length:91 Identity:62/91 - (68%)
Similarity:74/91 - (81%) Gaps:0/91 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKRTKKVGIVGKYGTRYGASLRKMVKKMEITQHSKYTCSFCGKDSMKRAVVGIWSCKRCKRTVA 65
            ||||||||||.||||.|||:|||:.|||:||.||::|.||||||.::||...|||:|..||:|||
Yeast     1 MAKRTKKVGITGKYGVRYGSSLRRQVKKLEIQQHARYDCSFCGKKTVKRGAAGIWTCSCCKKTVA 65

  Fly    66 GGAWVYSTTAAASVRSAVRRLRETKE 91
            |||:..||.|||:|||.:|||||..|
Yeast    66 GGAYTVSTAAAATVRSTIRRLREMVE 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37ANP_001188691.1 PTZ00255 1..90 CDD:240332 61/88 (69%)
RPL43BNP_012628.3 PTZ00255 1..88 CDD:240332 59/86 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345663
Domainoid 1 1.000 129 1.000 Domainoid score I1145
eggNOG 1 0.900 - - E1_COG1997
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H47964
Inparanoid 1 1.050 136 1.000 Inparanoid score I1208
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62221
OrthoFinder 1 1.000 - - FOG0001539
OrthoInspector 1 1.000 - - otm46735
orthoMCL 1 0.900 - - OOG6_100717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1138
SonicParanoid 1 1.000 - - X1113
TreeFam 1 0.960 - -
1413.690

Return to query results.
Submit another query.