DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37A and AT3G10950

DIOPT Version :9

Sequence 1:NP_001188691.1 Gene:RpL37A / 44783 FlyBaseID:FBgn0261608 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_187706.1 Gene:AT3G10950 / 820266 AraportID:AT3G10950 Length:92 Species:Arabidopsis thaliana


Alignment Length:91 Identity:60/91 - (65%)
Similarity:71/91 - (78%) Gaps:0/91 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKRTKKVGIVGKYGTRYGASLRKMVKKMEITQHSKYTCSFCGKDSMKRAVVGIWSCKRCKRTVA 65
            |.|||||..|||||||||||||||.:||||::||:||.|.||||.|:||.|||||.||.|.:..|
plant     1 MTKRTKKARIVGKYGTRYGASLRKQIKKMEVSQHNKYFCEFCGKYSVKRKVVGIWGCKDCGKVKA 65

  Fly    66 GGAWVYSTTAAASVRSAVRRLRETKE 91
            |||:..:|.:|.:|||.:|||||..|
plant    66 GGAYTMNTASAVTVRSTIRRLREQTE 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37ANP_001188691.1 PTZ00255 1..90 CDD:240332 59/88 (67%)
AT3G10950NP_187706.1 PTZ00255 1..89 CDD:240332 58/87 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 127 1.000 Domainoid score I1757
eggNOG 1 0.900 - - E1_COG1997
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H47964
Inparanoid 1 1.050 133 1.000 Inparanoid score I1857
OMA 1 1.010 - - QHG62221
OrthoDB 1 1.010 - - D1621758at2759
OrthoFinder 1 1.000 - - FOG0001539
OrthoInspector 1 1.000 - - otm2975
orthoMCL 1 0.900 - - OOG6_100717
Panther 1 1.100 - - LDO PTHR48129
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1113
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.