DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37A and RPL37A

DIOPT Version :9

Sequence 1:NP_001188691.1 Gene:RpL37A / 44783 FlyBaseID:FBgn0261608 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_000989.1 Gene:RPL37A / 6168 HGNCID:10348 Length:92 Species:Homo sapiens


Alignment Length:92 Identity:70/92 - (76%)
Similarity:81/92 - (88%) Gaps:0/92 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKRTKKVGIVGKYGTRYGASLRKMVKKMEITQHSKYTCSFCGKDSMKRAVVGIWSCKRCKRTVA 65
            ||||||||||||||||||||||||||||:||:||:|||||||||..|||..||||.|..|.:|||
Human     1 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSCMKTVA 65

  Fly    66 GGAWVYSTTAAASVRSAVRRLRETKEQ 92
            ||||.|:||:|.:|:||:|||:|.|:|
Human    66 GGAWTYNTTSAVTVKSAIRRLKELKDQ 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37ANP_001188691.1 PTZ00255 1..90 CDD:240332 68/88 (77%)
RPL37ANP_000989.1 Ribosomal_L37ae 4..88 CDD:396374 64/83 (77%)
C4-type zinc finger domain 39..69 20/29 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 144 1.000 Domainoid score I4624
eggNOG 1 0.900 - - E1_COG1997
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H47964
Inparanoid 1 1.050 154 1.000 Inparanoid score I4339
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62221
OrthoDB 1 1.010 - - D1621758at2759
OrthoFinder 1 1.000 - - FOG0001539
OrthoInspector 1 1.000 - - otm41024
orthoMCL 1 0.900 - - OOG6_100717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1138
SonicParanoid 1 1.000 - - X1113
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.770

Return to query results.
Submit another query.