DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37A and RGD1559951

DIOPT Version :9

Sequence 1:NP_001188691.1 Gene:RpL37A / 44783 FlyBaseID:FBgn0261608 Length:92 Species:Drosophila melanogaster
Sequence 2:XP_228717.1 Gene:RGD1559951 / 302528 RGDID:1559951 Length:100 Species:Rattus norvegicus


Alignment Length:92 Identity:52/92 - (56%)
Similarity:66/92 - (71%) Gaps:1/92 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKRTKKVGIVGKYGTRYGASLRKMVKKMEITQHSKYTCSFCGKDSMKRAVVGIWSCKRCKRTVA 65
            |||. :||..:|..||.|||||.||.||:.|.:|:||||:||||..|||..:|||.|..|..|||
  Rat     1 MAKH-QKVWNLGINGTCYGASLWKMAKKIAINRHAKYTCTFCGKTKMKRRAIGIWHCDPCMETVA 64

  Fly    66 GGAWVYSTTAAASVRSAVRRLRETKEQ 92
            .|...|:||:|.:|:||:|||:|.|:|
  Rat    65 VGPSTYNTTSAVTVKSAIRRLKEPKDQ 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37ANP_001188691.1 PTZ00255 1..90 CDD:240332 50/88 (57%)
RGD1559951XP_228717.1 Ribosomal_L37ae 2..87 CDD:280032 48/85 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621758at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.