DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37A and rpl4301

DIOPT Version :9

Sequence 1:NP_001188691.1 Gene:RpL37A / 44783 FlyBaseID:FBgn0261608 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_595105.1 Gene:rpl4301 / 2540682 PomBaseID:SPBC800.04c Length:94 Species:Schizosaccharomyces pombe


Alignment Length:93 Identity:56/93 - (60%)
Similarity:70/93 - (75%) Gaps:2/93 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKRTKKVGIVGKYGTRYGASLRKMVKKMEITQHSKYTCSFCGKDSMKRAVVGIWSC--KRCKRT 63
            |.|||||||:.||||.|||||||:.|:|:|:.|||:|.|.|||::::||...|||.|  |.||:.
pombe     1 MTKRTKKVGVTGKYGVRYGASLRRDVRKIEVQQHSRYQCPFCGRNTVKRTAAGIWCCNGKGCKKV 65

  Fly    64 VAGGAWVYSTTAAASVRSAVRRLRETKE 91
            :|||||..:|.||.|.||.:|||||..|
pombe    66 LAGGAWTVTTAAATSARSTIRRLREMVE 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37ANP_001188691.1 PTZ00255 1..90 CDD:240332 55/90 (61%)
rpl4301NP_595105.1 Ribosomal_L37ae 1..90 CDD:302811 53/88 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 120 1.000 Domainoid score I1459
eggNOG 1 0.900 - - E1_COG1997
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H47964
Inparanoid 1 1.050 124 1.000 Inparanoid score I1464
OMA 1 1.010 - - QHG62221
OrthoFinder 1 1.000 - - FOG0001539
OrthoInspector 1 1.000 - - otm47187
orthoMCL 1 0.900 - - OOG6_100717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1138
SonicParanoid 1 1.000 - - X1113
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.