DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37A and Rpl37a

DIOPT Version :9

Sequence 1:NP_001188691.1 Gene:RpL37A / 44783 FlyBaseID:FBgn0261608 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_033110.1 Gene:Rpl37a / 19981 MGIID:98068 Length:92 Species:Mus musculus


Alignment Length:92 Identity:70/92 - (76%)
Similarity:81/92 - (88%) Gaps:0/92 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKRTKKVGIVGKYGTRYGASLRKMVKKMEITQHSKYTCSFCGKDSMKRAVVGIWSCKRCKRTVA 65
            ||||||||||||||||||||||||||||:||:||:|||||||||..|||..||||.|..|.:|||
Mouse     1 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSCMKTVA 65

  Fly    66 GGAWVYSTTAAASVRSAVRRLRETKEQ 92
            ||||.|:||:|.:|:||:|||:|.|:|
Mouse    66 GGAWTYNTTSAVTVKSAIRRLKELKDQ 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37ANP_001188691.1 PTZ00255 1..90 CDD:240332 68/88 (77%)
Rpl37aNP_033110.1 Ribosomal_L37ae 4..88 CDD:396374 64/83 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 144 1.000 Domainoid score I4604
eggNOG 1 0.900 - - E1_COG1997
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H47964
Inparanoid 1 1.050 154 1.000 Inparanoid score I4309
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62221
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001539
OrthoInspector 1 1.000 - - oto93049
orthoMCL 1 0.900 - - OOG6_100717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1138
SonicParanoid 1 1.000 - - X1113
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.