DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL37A and rpl-43

DIOPT Version :9

Sequence 1:NP_001188691.1 Gene:RpL37A / 44783 FlyBaseID:FBgn0261608 Length:92 Species:Drosophila melanogaster
Sequence 2:NP_496957.1 Gene:rpl-43 / 175070 WormBaseID:WBGene00004456 Length:91 Species:Caenorhabditis elegans


Alignment Length:91 Identity:66/91 - (72%)
Similarity:78/91 - (85%) Gaps:0/91 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKRTKKVGIVGKYGTRYGASLRKMVKKMEITQHSKYTCSFCGKDSMKRAVVGIWSCKRCKRTVA 65
            |||||||||||||||||||||||||.||:|:.|||:||||||||::|||...|||:|.:|.:.||
 Worm     1 MAKRTKKVGIVGKYGTRYGASLRKMAKKLEVAQHSRYTCSFCGKEAMKRKATGIWNCAKCHKVVA 65

  Fly    66 GGAWVYSTTAAASVRSAVRRLRETKE 91
            |||:||.|..||:|||.:||||:.||
 Worm    66 GGAYVYGTVTAATVRSTIRRLRDLKE 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL37ANP_001188691.1 PTZ00255 1..90 CDD:240332 64/88 (73%)
rpl-43NP_496957.1 PTZ00255 1..90 CDD:240332 64/88 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165398
Domainoid 1 1.000 138 1.000 Domainoid score I3006
eggNOG 1 0.900 - - E1_COG1997
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H47964
Inparanoid 1 1.050 148 1.000 Inparanoid score I2989
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62221
OrthoDB 1 1.010 - - D1621758at2759
OrthoFinder 1 1.000 - - FOG0001539
OrthoInspector 1 1.000 - - oto19152
orthoMCL 1 0.900 - - OOG6_100717
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1138
SonicParanoid 1 1.000 - - X1113
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.740

Return to query results.
Submit another query.