DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ady43A and yihV

DIOPT Version :9

Sequence 1:NP_651995.1 Gene:Ady43A / 44750 FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_418319.2 Gene:yihV / 948382 ECOCYCID:EG11848 Length:298 Species:Escherichia coli


Alignment Length:352 Identity:80/352 - (22%)
Similarity:126/352 - (35%) Gaps:94/352 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KVICFGNVLLDRLVQLEDPQLLERFGLELGSKGELDMEKLNQLAAEASESSRCLTNPGGSALNTA 94
            :|.|.|..::||:..:|.                |..|....:|...:|..      ||.|...|
E. coli     3 RVACVGITVMDRIYYVEG----------------LPTESGKYVARNYTEVG------GGPAATAA 45

  Fly    95 RILKQLGTDALFFGAVGADKHAEELRQIIRDRGIEAR-LQTVEDAHTGQCVCLMYQDNPTLYANI 158
            ....:||....|.|.||.|.....|...:...|:..| .:....|.:.|...::......:..|.
E. coli    46 VAAARLGAQVDFIGRVGDDDTGNSLLAELESWGVNTRYTKRYNQAKSSQSAIMVDTKGERIIINY 110

  Fly   159 GAS--------------AQFEVQTLSHAVSHEG--QSFLRPVERKQILYVEGFFVPQRSDVCDYI 207
            .:.              :|::| .|:....|:|  ::|....:...:..::|...||  |:.:.:
E. coli   111 PSPDLLPDAEWLEEIDFSQWDV-VLADVRWHDGAKKAFTLARQAGVMTVLDGDITPQ--DISELV 172

  Fly   208 VQHLVRERRRLALNLSAPYIVRKNHQAMMK--LARAAFFLFGNRQEFEALAEAAGGFRNVDELAD 270
                       ||:         :|.|..:  |||    |.|.::...||.:|            
E. coli   173 -----------ALS---------DHAAFSEPGLAR----LTGVKEMASALKQA------------ 201

  Fly   271 HLLQSGGTKVIFVTNGSAGVQVITNYVEELAPPGPVSFEDFRAQRVEQLVDATGAGDAFVAGFLH 335
            ..|.:|.   ::||.||||...:.|...:..|          |.:|: :||.|||||.|......
E. coli   202 QTLTNGH---VYVTQGSAGCDWLENGGRQHQP----------AFKVD-VVDTTGAGDVFHGALAV 252

  Fly   336 AWLEKRSLGECIRMASSVAAKVVTQVG 362
            |......|.|.:|.||.|||...|:.|
E. coli   253 ALATSGDLAESVRFASGVAALKCTRPG 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 80/352 (23%)
PTZ00247 28..366 CDD:240328 80/352 (23%)
yihVNP_418319.2 ribokinase_group_B 3..286 CDD:238920 80/352 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.