DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ady43A and kdgK

DIOPT Version :9

Sequence 1:NP_651995.1 Gene:Ady43A / 44750 FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_417983.2 Gene:kdgK / 948041 ECOCYCID:EG12253 Length:309 Species:Escherichia coli


Alignment Length:303 Identity:67/303 - (22%)
Similarity:122/303 - (40%) Gaps:49/303 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 GGSALNTA-RILKQLGTDAL---FFGAVGADKHAEELRQIIRDRGIEARL-QTVEDAHTGQCVCL 146
            ||..|||: .|.:|:...||   :..|:|.|..::::........::..| |.:|:...|    |
E. coli    27 GGDTLNTSVYIARQVDPAALTVHYVTALGTDSFSQQMLDAWHGENVDTSLTQRMENRLPG----L 87

  Fly   147 MYQDNPT------LYANIGASAQFEVQT-LSHAVSHEGQSFLRPVERKQILYVEGFFVPQRSDVC 204
            .|.:..:      .|....|:|:|.::: .|.|:..|..:|       ..||:.|..:...|...
E. coli    88 YYIETDSTGERTFYYWRNEAAAKFWLESEQSAAICEELANF-------DYLYLSGISLAILSPTS 145

  Fly   205 DYIVQHLVRERRR-----LALNLSAPYI------VRKNHQAMMKLARAAFFLFGNRQEFEALAEA 258
            ...:..|:||.|.     :..|...|.:      .::.:|.|::....||....:.       :|
E. coli   146 REKLLSLLRECRANGGKVIFDNNYRPRLWASKEETQQVYQQMLECTDIAFLTLDDE-------DA 203

  Fly   259 AGGFRNVDELADHLLQSGGTKVIFVTNGSAGVQVITNYVEELAPPGPVSFEDFRAQRVEQLVDAT 323
            ..|.:.|:::... ..:.|.|.:.|..|:....|      .:|..|.|.....:..: |:::|.|
E. coli   204 LWGQQPVEDVIAR-THNAGVKEVVVKRGADSCLV------SIAGEGLVDVPAVKLPK-EKVIDTT 260

  Fly   324 GAGDAFVAGFLHAWLEKRSLGECIRMASSVAAKVVTQVGCNLP 366
            .|||:|.||:|...|...|..:..:.....|:.|:...|..:|
E. coli   261 AAGDSFSAGYLAVRLTGGSAEDAAKRGHLTASTVIQYRGAIIP 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 66/301 (22%)
PTZ00247 28..366 CDD:240328 66/301 (22%)
kdgKNP_417983.2 KdgK 4..301 CDD:238571 66/299 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.