DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ady43A and frlD

DIOPT Version :9

Sequence 1:NP_651995.1 Gene:Ady43A / 44750 FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_417833.1 Gene:frlD / 947886 ECOCYCID:G7726 Length:261 Species:Escherichia coli


Alignment Length:307 Identity:64/307 - (20%)
Similarity:103/307 - (33%) Gaps:102/307 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 GGSALNTARILKQLGTDALFFGAVGADKHAEELRQIIRDRGIEARLQTVEDAHTGQCVCLMYQ-- 149
            ||:|:|.|....:.|........||.|.:..:|:|.:...|::     :...||...|....|  
E. coli    24 GGNAVNVAVYCTRYGIQPGCITWVGDDDYGTKLKQDLARMGVD-----ISHVHTKHGVTAQTQVE 83

  Fly   150 --DNPTLYANI--GASAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFFVPQRSDVCDYIVQH 210
              ||..::.:.  |..|.|       |:|.|..::|                             
E. coli    84 LHDNDRVFGDYTEGVMADF-------ALSEEDYAWL----------------------------- 112

  Fly   211 LVRERRRLALNLSAPYIVRKNHQAMMKLARAAFFLFGNRQEFEALAEAAGGFRNVD--------- 266
                                   |...:..||  ::|:.::......|||.....|         
E. coli   113 -----------------------AQYDIVHAA--IWGHAEDAFPQLHAAGKLTAFDFSDKWDSPL 152

  Fly   267 --ELADHL-------LQSGGT---KVIFVTNGSAGVQVITNYVEELAPPGPVSFE--DFRAQRVE 317
              .|..||       .|...|   |:..:....||..::|     |...|.::::  .|..|..|
E. coli   153 WQTLVPHLDFAFASAPQEDETLRLKMKAIVARGAGTVIVT-----LGENGSIAWDGAQFWRQAPE 212

  Fly   318 --QLVDATGAGDAFVAGFLHAWLEKRSLGECIRMASSVAAKVVTQVG 362
              .::|..||||:|:||||..|....:|.:.|...::.|||.:...|
E. coli   213 PVTVIDTMGAGDSFIAGFLCGWSAGMTLPQAIAQGTACAAKTIQYHG 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 64/307 (21%)
PTZ00247 28..366 CDD:240328 64/307 (21%)
frlDNP_417833.1 PRK09813 2..261 CDD:182090 64/307 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.