DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ady43A and yegV

DIOPT Version :9

Sequence 1:NP_651995.1 Gene:Ady43A / 44750 FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_416603.1 Gene:yegV / 946637 ECOCYCID:G7132 Length:321 Species:Escherichia coli


Alignment Length:304 Identity:65/304 - (21%)
Similarity:101/304 - (33%) Gaps:76/304 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 NPGGSALNTARILKQLGTDALFFGAVGADKHAEELRQIIRDRGIEARLQTVEDAHTGQCVCLMYQ 149
            |.||.|||.|..||:||.:|.....:|....||.:|..:...|:.:.:...| ...|.|:.|:..
E. coli    51 NVGGCALNIAVALKRLGIEAGNALPLGQGVWAEMIRNRMAKEGLISLIDNAE-GDNGWCLALVEP 114

  Fly   150 DNPTLYANI-GASAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGF------------------ 195
            |....:.:. |...|:..|.|:......|          .:||..|:                  
E. coli   115 DGERTFMSFSGVENQWNRQWLARLTVAPG----------SLLYFSGYQLASPCGELLVEWLEELQ 169

  Fly   196 -------FVPQRSDVCDYIVQHLVRERRRLALNLSAPYIVRKNHQAMMKLARAAFFLFGNRQEFE 253
                   |.|:..|:.|.::..::..|..::|                           ||||.|
E. coli   170 DVTPFIDFGPRIGDIPDALLARIMACRPLVSL---------------------------NRQEAE 207

  Fly   254 ALAEAAGGFRNVDELADHLLQSGGTKVIFVTNGSAGVQVITNYVEELAPPGPVSFEDFRAQRVEQ 318
            ..||.......:..|.....:.....:| |.....|....:|......|..|.           |
E. coli   208 IAAERFALSAEITTLGKQWQEKFAAPLI-VRLDKEGAWYFSNDASGCIPAFPT-----------Q 260

  Fly   319 LVDATGAGDAFVAGFLHAWLEKRSLGECIRMASSVAAKVVTQVG 362
            :||..||||:...|.|........|.:.:.:.::||:.||...|
E. coli   261 VVDTIGAGDSHAGGVLAGLASGLPLADAVLLGNAVASWVVGHRG 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 65/304 (21%)
PTZ00247 28..366 CDD:240328 65/304 (21%)
yegVNP_416603.1 YegV_kinase_like 18..304 CDD:238919 64/302 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.