DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ady43A and pfkB

DIOPT Version :9

Sequence 1:NP_651995.1 Gene:Ady43A / 44750 FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_416237.3 Gene:pfkB / 946230 ECOCYCID:EG10700 Length:309 Species:Escherichia coli


Alignment Length:313 Identity:67/313 - (21%)
Similarity:109/313 - (34%) Gaps:75/313 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 RC---LTNPGGSALNTARILKQLGTDA-LFFGAVGADKHAEELRQIIRDRG-----IEARLQTVE 136
            ||   :..|||..:|.||.:..||..| ..|.|.||.  .|.|..::.|..     :||:..|.:
E. coli    29 RCTAPVFEPGGGGINVARAIAHLGGSATAIFPAGGAT--GEHLVSLLADENVPVATVEAKDWTRQ 91

  Fly   137 DAH-----TGQCVCLMYQDNPTLYANIGASAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFF 196
            :.|     :|:....:.   |....|.....|.|.|.|.             :|...||.:.|..
E. coli    92 NLHVHVEASGEQYRFVM---PGAALNEDEFRQLEEQVLE-------------IESGAILVISGSL 140

  Fly   197 VP-----QRSDVCDYIVQHLVR-------ERRRLALNLSAPYIVRKNHQAMMKLARAAFFLFGNR 249
            .|     :.:.:.....:..:|       |....||.:....:|:.|.:.:..|.        ||
E. coli   141 PPGVKLEKLTQLISAAQKQGIRCIVDSSGEALSAALAIGNIELVKPNQKELSALV--------NR 197

  Fly   250 QEFEALAEAAGGFRNVDELADHLLQSGGTKVIFVTNGSAGVQVI--TNYVEELAPPGPVSFEDFR 312
            :..:.        .:|.:.|..::.||..|.:.|:.|..|...:  .|.::.:.||       .:
E. coli   198 ELTQP--------DDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQVVPPP-------VK 247

  Fly   313 AQRVEQLVDATGAGDAFVAGFLHAWLEKRSLGECIRMASSVAAKVVTQVGCNL 365
            :|      ...||||:.|........|..||.|.:|...:..:......|..|
E. coli   248 SQ------STVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRL 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 67/313 (21%)
PTZ00247 28..366 CDD:240328 67/313 (21%)
pfkBNP_416237.3 PRK10294 1..309 CDD:182361 67/313 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I673
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I458
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.