DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ady43A and RBK1

DIOPT Version :9

Sequence 1:NP_651995.1 Gene:Ady43A / 44750 FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_009965.2 Gene:RBK1 / 850402 SGDID:S000000632 Length:333 Species:Saccharomyces cerevisiae


Alignment Length:328 Identity:66/328 - (20%)
Similarity:129/328 - (39%) Gaps:70/328 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 AAEASESSRCLTNPGGSALNTARILKQLGT-----DALFFGAVGADKHAEELRQIIRDRGIE-AR 131
            |.|...::...|:.||..||.|..:.:|..     .....|.||.|...::|:..:.|.|:: ..
Yeast    23 AGETFRANHFETHAGGKGLNQAAAIGKLKNPSSRYSVRMIGNVGNDTFGKQLKDTLSDCGVDITH 87

  Fly   132 LQTVEDAHTGQCVCLMYQDNPTLYANIGASAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFF 196
            :.|.|..:||....|:.:.         |..|..:..:      ||.:.....:.||:..:    
Yeast    88 VGTYEGINTGTATILIEEK---------AGGQNRILIV------EGANSKTIYDPKQLCEI---- 133

  Fly   197 VPQRSDVCDYIV-QHLV-------------RERRRLALNLSAPY--IVRKNHQAM---------- 235
            .|:..:..:|:| ||.:             |...::..|.| |:  :.:|:.:.:          
Yeast   134 FPEGKEEEEYVVFQHEIPDPLSIIKWIHANRPNFQIVYNPS-PFKAMPKKDWELVDLLVVNEIEG 197

  Fly   236 MKLARAAFFLFGNRQEFEALAEA-----AGGFRNVDELA-DHLLQSGGTKVIFVTNGSAGVQVIT 294
            :::..:.|    :.:..|.:.|.     .|.:|.:.||. :.|:......::.:|.||.||...:
Yeast   198 LQIVESVF----DNELVEEIREKIKDDFLGEYRKICELLYEKLMNRKKRGIVVMTLGSRGVLFCS 258

  Fly   295 NYVEELAPPGPVSFEDFRAQRVEQLVDATGAGDAFVAGFLHAWLEKRSLGECIRMASSVAAKVVT 359
            :...|      |.|  ..|.:...:||.|||||.|:.|.:....:..:|...|:.::..::..:.
Yeast   259 HESPE------VQF--LPAIQNVSVVDTTGAGDTFLGGLVTQLYQGETLSTAIKFSTLASSLTIQ 315

  Fly   360 QVG 362
            :.|
Yeast   316 RKG 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 66/328 (20%)
PTZ00247 28..366 CDD:240328 66/328 (20%)
RBK1NP_009965.2 ribokinase 2..324 CDD:238579 66/328 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.