DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ady43A and FLN2

DIOPT Version :9

Sequence 1:NP_651995.1 Gene:Ady43A / 44750 FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_177080.3 Gene:FLN2 / 843251 AraportID:AT1G69200 Length:614 Species:Arabidopsis thaliana


Alignment Length:369 Identity:66/369 - (17%)
Similarity:117/369 - (31%) Gaps:113/369 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DDTQGAFHTPRKVICFGNVL---------LDRLVQLEDPQLLERFGLELGSKGELDMEKLNQLAA 74
            :|....:..|..|.|||:..         .:||:   |.:|.||.                :.|.
plant   195 EDISHTYGWPPLVCCFGSAQHAFVPSGRPANRLL---DYELHERM----------------RDAK 240

  Fly    75 EASESSRCLTNPGGSALNTARILKQLGTDALFFGAVGADKHAEELRQIIRDRGIEARLQTVEDAH 139
            .|.|  :.:..|||.|...|..|..||....|.|.:|||.:.:.:...:....::.|...::...
plant   241 WAPE--KYIRAPGGCAGGVAIALASLGGKVAFMGKLGADDYGQAMLYYLNVCKVQTRSVKIDGKR 303

  Fly   140 TGQCVCLMYQDNPTLYANI---GASAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFFVPQRS 201
            ...|..:.......|.:..   .|........::..|..|.:.|                     
plant   304 VTACSTMKISKRGRLKSTCIKPCAEDSLSKSEINVDVLKEAKMF--------------------- 347

  Fly   202 DVCDYIVQHLVRERRRLALNLSAPYIVRKNHQAMMKLARAAFF-------LFGNRQEFEALAEAA 259
                |...|.:.:::.::..:.|..|.:       :|....|:       |:.:.:|.::..:..
plant   348 ----YFSTHSLLDKKMMSTTIQAIKISK-------QLGNVIFYDLNLPLPLWHSSEETKSFIQEV 401

  Fly   260 GGFRNVDELADHLLQ---------------------------------SGGTKVIFVTNGSAGVQ 291
            ....:|.|:....|:                                 ....||:|||||::.:.
plant   402 WNLADVIEITKQELEFLCGIEPTEEFDTENNDISKFVHYPPETVEQLWHENLKVLFVTNGTSKIH 466

  Fly   292 VITNYVEELAPPGPVS-FEDFRAQRVEQLVDATGAGDAFVAGFL 334
            .   |.:|  ..|.|| .||.......:  |.:.:||..|||.:
plant   467 Y---YTKE--HNGAVSGMEDVPITPFTR--DMSASGDGIVAGLI 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 65/360 (18%)
PTZ00247 28..366 CDD:240328 65/360 (18%)
FLN2NP_177080.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.