DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ady43A and AT1G19600

DIOPT Version :9

Sequence 1:NP_651995.1 Gene:Ady43A / 44750 FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_173390.1 Gene:AT1G19600 / 838547 AraportID:AT1G19600 Length:355 Species:Arabidopsis thaliana


Alignment Length:352 Identity:84/352 - (23%)
Similarity:138/352 - (39%) Gaps:73/352 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LLDRLVQLEDPQLLERFGLELG-----SKGELDMEKLNQLAAEASESSRCLTNP-----GGSALN 92
            |:|.:..: |..||::...:.|     .|.||: ..|.:|.|..|.:      |     |||..|
plant    23 LIDNVAPV-DWSLLDQIPGDRGGSIAVQKDELE-HMLKELDAHISVA------PLKKMAGGSVTN 79

  Fly    93 TARILK-QLGTDALFFGAVGADKHAEELRQIIRDRGIEARLQTVEDAHTGQCVCLMYQD-NPTLY 155
            |.|.|. ..|......||.|.|:..:.....:...|:.......:...|.|||||:... |.|:.
plant    80 TVRGLSVGFGVATGIIGAYGDDEQGQLFVSNMGFSGVSISRLRKKKGSTAQCVCLVDDSGNRTMR 144

  Fly   156 ANIGASAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFFVPQRSDVCDYIVQHLVRERRRLAL 220
            ..:.::.:.:...||.. ...|..:|  |.|..:|.::             ::|..:|..::..|
plant   145 PCLSSAVKIQADELSKE-DFTGSKWL--VLRYAVLNLQ-------------VIQAAIRFAKQEGL 193

  Fly   221 NLSAPYIVRKNHQAMMKLARAAFFLFGN-RQEFEALAEAAG---GFRNVDELADHLL--QSGGTK 279
            ::|              |..|:|.:..| :.|...|.|:..   .|.|.||.|:.|.  |..|.:
plant   194 SVS--------------LDLASFEMVRNSKSELRQLLESGNIDLCFANEDEAAELLRGEQEAGPE 244

  Fly   280 VIFVTNGSAGVQVITNY----VEELAPPGPVSFEDFRAQRVEQL-----VDATGAGDAFVAGFLH 335
                    |.::.:..:    |..|...|.::..|.....:..:     .|||||||.|.:|||:
plant   245 --------AALEFLGRHCRWAVVTLGSKGCIAKHDKEVVHISAIGETVATDATGAGDLFASGFLY 301

  Fly   336 AWLEKRSLGECIRMASSVAAKVVTQVG 362
            ..::..||.||.::.|.....|:..:|
plant   302 GLIKGLSLEECCKVGSCSGGSVIRALG 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 84/352 (24%)
PTZ00247 28..366 CDD:240328 84/352 (24%)
AT1G19600NP_173390.1 PLN02379 1..355 CDD:178005 84/352 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1226324at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.