DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ady43A and AT1G17160

DIOPT Version :9

Sequence 1:NP_651995.1 Gene:Ady43A / 44750 FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_173159.1 Gene:AT1G17160 / 838287 AraportID:AT1G17160 Length:379 Species:Arabidopsis thaliana


Alignment Length:377 Identity:82/377 - (21%)
Similarity:130/377 - (34%) Gaps:116/377 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HTPRKVICFGNVLLDRLVQLEDPQLLERFGLELGSKGELDMEKLNQLAAEASESSRCLTNPGGSA 90
            |.|..|: .|:...|..|::|          .|..:||....|..|..|            ||..
plant    67 HAPPLVV-VGSANADIYVEIE----------RLPKEGETISAKTGQTLA------------GGKG 108

  Fly    91 LNTARILKQLGTDALFFGAVGADKHAEELRQIIRDRGIEARL---QTVEDAHTGQCVCLMYQDNP 152
            .|.|....:|.....|.|.:|.|.|.:.:.:.:.|.|....|   ::|.:..||..|.::..|..
plant   109 ANQAACGAKLMYPTYFVGRLGEDAHGKLIAEALGDDGCGVHLDYVRSVNNEPTGHAVVMLQSDGQ 173

  Fly   153 TLYANIGAS------------------------AQFEVQ-----TLSHAVSHEGQSFLRPVERKQ 188
            .....:|.:                        .|.|:.     .::.||...|.    ||    
plant   174 NSIIIVGGANMKAWPEIMSDDDLEIVRNAGIVLLQREIPDSINIQVAKAVKKAGV----PV---- 230

  Fly   189 ILYVEGFFVPQRSDVCDYIVQHLVRERRRLALNLSAPYIVRKNHQAMMKLARAAFFLFGNRQEFE 253
            ||.|.|...|..:::.|             ::::.:|     |...:.:|....      .:.||
plant   231 ILDVGGMDTPIPNELLD-------------SIDILSP-----NETELSRLTGMP------TETFE 271

  Fly   254 ALAEAAGGFRNVDELADHLLQSGGTKVIFVTNGSAG----VQVITNYVEELAPPGPVSFEDFRAQ 314
            .:::|......:           |.|.:.|..||.|    :|......:.:.|            
plant   272 QISQAVAKCHKL-----------GVKQVLVKLGSKGSALFIQGEKPIQQSIIP------------ 313

  Fly   315 RVEQLVDATGAGDAFVAGFLHAWLEKRSLGECIRMASSVAAKVVTQVGCNLP 366
             ..|:||.|||||.|.|.|..|.:|.:|..||:|.|:: ||.:..||...:|
plant   314 -AAQVVDTTGAGDTFTAAFAVAMVEGKSHEECLRFAAA-AASLCVQVKGAIP 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 80/373 (21%)
PTZ00247 28..366 CDD:240328 80/373 (21%)
AT1G17160NP_173159.1 ribokinase 70..367 CDD:238579 80/374 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.