DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ady43A and Mik

DIOPT Version :9

Sequence 1:NP_651995.1 Gene:Ady43A / 44750 FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_200681.1 Gene:Mik / 835987 AraportID:AT5G58730 Length:353 Species:Arabidopsis thaliana


Alignment Length:369 Identity:73/369 - (19%)
Similarity:127/369 - (34%) Gaps:108/369 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NPPTDDTQGAFHTP-----RKVICFGNVLLDRLVQLEDPQLLERFGLELGSKGELDMEKLNQLAA 74
            |||  .:|...|:|     |:|:..||...|.|:|                .|.:..|.|     
plant     4 NPP--PSQQTSHSPRRIPNRRVLIVGNYCHDVLIQ----------------NGSVVAETL----- 45

  Fly    75 EASESSRCLTNPGGSALNTARILKQLGTDALFFGAVGADKHAEELRQII-------------RDR 126
                        ||:|...:.:|............||.|...|.....|             .|.
plant    46 ------------GGAASFISNVLDSSSVSCDLVSKVGHDFRYEVTHSPIVAPEKETTVFEAYFDL 98

  Fly   127 GIEARLQTVEDAHTGQCVCLMYQDNPTLYANIGASAQFEVQTLSHAVSHEGQSFLRPVERKQILY 191
            ||:.      ..|..:.:..:...:|.|.::| ..::|:   ...||...|:.....:|:     
plant    99 GIDG------IGHADRVLKRVSACDPILPSDI-PDSRFD---FGMAVGVGGEILPETLEK----- 148

  Fly   192 VEGFFVPQRSDVCDYI---VQHLVRERRRLALNLSAPYIVRKNHQAMMKLARAAFFLFGNRQEFE 253
                    ..::||.:   :|.|:|        :..|.   .....::.|..:.|:...:|..|.
plant   149 --------MVEICDVVAVDIQALIR--------VFDPV---DGAVKLVDLKESGFYHILHRIGFL 194

  Fly   254 ALAEAAGGFRNVDELADHLLQSGGTKVIFVTNGSAGVQVITNYVEELAPPGPVSFEDFRAQRVEQ 318
            ..:.....|.:|::: .||.      .:.||||..|.::.....|...||       |.|::   
plant   195 KASSDEALFMDVEQM-KHLC------CVVVTNGEKGCRIYHKDDEMTVPP-------FLAKQ--- 242

  Fly   319 LVDATGAGDAFVAGFLHAWLEKRSLGECIRMASSVAAKVVTQVG 362
             ||.|||||:|:.|.:...:|..::.:...:.:...:..|..:|
plant   243 -VDPTGAGDSFLGGLIVGLVEGLTVPDAALLGNLFGSITVEHIG 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 68/356 (19%)
PTZ00247 28..366 CDD:240328 68/356 (19%)
MikNP_200681.1 PLN02630 10..344 CDD:178237 69/361 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.