DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ady43A and AT5G51830

DIOPT Version :9

Sequence 1:NP_651995.1 Gene:Ady43A / 44750 FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001318782.1 Gene:AT5G51830 / 835258 AraportID:AT5G51830 Length:343 Species:Arabidopsis thaliana


Alignment Length:378 Identity:82/378 - (21%)
Similarity:132/378 - (34%) Gaps:124/378 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VICFGNVLLDRLVQLEDPQLLERFGLELGSKGELDMEKLNQLAAEASESSRCLTNPGGSALNTAR 95
            |:|||.:|:|.:..:.        |:.|               |||....:.   |||:..|.|.
plant    24 VVCFGEMLIDFVPTVG--------GVSL---------------AEAPAFKKA---PGGAPANVAV 62

  Fly    96 ILKQLGTDALFFGAVGADKHAEELRQIIRDRGIEARLQTVEDAHTGQCVCLMYQDNPTLYANIGA 160
            .:.:||..:.|.|.||.|:....|..|:|...:                     ||..:..:..|
plant    63 GVSRLGGSSAFIGKVGDDEFGRMLADILRLNNV---------------------DNSGMRFDHNA 106

  Fly   161 SAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFF---VPQRSDVCDYIVQHLVRERRRLALNL 222
            .......||......|...|..|  ...:|.:|...   :.|::.:..|....|:.|.       
plant   107 RTALAFVTLRGDGEREFLFFRHP--SADMLLLESELDKNLIQKAKIFHYGSISLIEEP------- 162

  Fly   223 SAPYIVRKNHQAMMKLARAAFFLF---------------GNRQEFEALAEAA------------- 259
                 .|......||:|:||..|.               ..|:|..::...|             
plant   163 -----CRSTQLVAMKIAKAAGSLLSYDPNLRLPLWPSEEAARKEIMSIWNLADVIKISEDEITFL 222

  Fly   260 -GGFRNVDELADHLLQS---GGTKVIFVTNGSAGVQVITNYVEELAPPGPVSFEDFRAQ----RV 316
             ||....|:  |.:||.   ...|::.|:.|..|.:..|              ::|:.:    :|
plant   223 TGGDDPYDD--DVVLQKLFHPNLKLLVVSEGPNGCRYYT--------------QEFKGRVGGVKV 271

  Fly   317 EQLVDATGAGDAFVAGFLHAWL-------EKRSLGECIRMASSVAAKVVTQVG 362
            :. ||.||||||||:|.|::..       :::.|.|.:..|::..|..||:.|
plant   272 KP-VDTTGAGDAFVSGLLNSLASDLTLLKDEKKLREALLFANACGAITVTERG 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 82/378 (22%)
PTZ00247 28..366 CDD:240328 82/378 (22%)
AT5G51830NP_001318782.1 PLN02323 13..343 CDD:215183 82/378 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.