DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ady43A and AT5G43910

DIOPT Version :9

Sequence 1:NP_651995.1 Gene:Ady43A / 44750 FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_974877.1 Gene:AT5G43910 / 834413 AraportID:AT5G43910 Length:365 Species:Arabidopsis thaliana


Alignment Length:331 Identity:68/331 - (20%)
Similarity:115/331 - (34%) Gaps:78/331 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 GGSALNTARILKQLGTDALFFGAVGADKHAEELRQIIRDRGIEARL------------QTVEDAH 139
            ||:..|....:.:||........|..|.|...:.:.:...|::...            ..:.|..
plant    49 GGNTGNALTCVARLGLPCRILAKVADDSHGRYMVEELESSGVDTSFCMSAKDGASHFNYVIVDNQ 113

  Fly   140 TGQCVCLMYQDNP--------------------TLYANIGASAQFEVQTLSHAVSHEGQSFLRPV 184
            |....|:.....|                    .||.| |.|.:.|: .|:.....:....|...
plant   114 TNTRTCIYTPGYPPLLPDDLTESLLLDVLDGVRVLYVN-GRSREAEL-LLAQKAHSKNIPILINA 176

  Fly   185 ERKQILYVEGFFVPQRSDVCDYIV--QHLVRE--------RRRLALNLSAP----YIVRKNHQAM 235
            |:|:.      .:.:..|:.||.:  .:..:|        ...|::.:..|    .|:.......
plant   177 EKKRT------GLDELIDLADYAICSTNFPQEWTGAPSSPSALLSMLIRLPKLKFVIMTLGEHGC 235

  Fly   236 MKLARAAFFLFGNRQEFEALAEAAGGFRNVDELADHLLQSGG-TKVIFVTNGSAGVQVITNYVEE 299
            :.|.|.:..:.|:.:|           .::|||.:.|.||.. |.|:.|.|.|...::..|....
plant   236 VMLERCSSEVSGSEEE-----------TDIDELHESLKQSTDFTSVLPVCNSSLVTRLTGNVTGR 289

  Fly   300 LAPPGPVSFEDFRAQRV--EQLVDATGAGDAFVAGFLHAWLEKRSLGECIRMASSVAAKVVTQVG 362
            |.        ...|:::  .:|:|.|||||||....|:......:|.|.:..||.|||.....:|
plant   290 LV--------IVTAEKIPSSELIDTTGAGDAFTGALLYGLCTGMALEEMLTFASRVAACCCRGLG 346

  Fly   363 C--NLP 366
            .  :||
plant   347 ARTSLP 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 66/329 (20%)
PTZ00247 28..366 CDD:240328 66/329 (20%)
AT5G43910NP_974877.1 ribokinase_group_B 14..353 CDD:238920 68/331 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.