DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ady43A and ADK2

DIOPT Version :9

Sequence 1:NP_651995.1 Gene:Ady43A / 44750 FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_195950.1 Gene:ADK2 / 831882 AraportID:AT5G03300 Length:345 Species:Arabidopsis thaliana


Alignment Length:342 Identity:87/342 - (25%)
Similarity:156/342 - (45%) Gaps:27/342 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GNVLLDRLVQLEDPQLLERFGLELGSKGELDMEKLNQLAAEASESSRCLTNPGGSALNTARI--- 96
            ||.||| :..:.|.:.|.::.::| :...|..:|...:..|.|.........||:..|:.::   
plant    15 GNPLLD-ISAVVDDEFLTKYDIKL-NNAILAEDKHLPMYDEMSSKFNVEYIAGGATQNSIKVAQW 77

  Fly    97 LKQLGTDALFFGAVGADKHAEELRQIIRDRGIEARLQTVEDAHTGQC-VCLMYQDNPTLYANIGA 160
            :.|:.....:.|::|.||:.|.:::.....|:.......|.|.||.| ||::..:. :|.||:.|
plant    78 MLQIPGATSYMGSIGKDKYGEAMKKDATAAGVNVHYYEDESAPTGTCGVCVVGGER-SLIANLSA 141

  Fly   161 SAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFFVPQRSDVCDYIVQHLVRERRRLALNLSAP 225
            :..::|   .|....|..:.   ||:.:..|:.|||:....:....:.:|.....:...:|||||
plant   142 ANCYKV---DHLKKPENWAL---VEKAKFYYIAGFFLTVSPESIQLVSEHAAANNKVFTMNLSAP 200

  Fly   226 YIVRKNHQAMMKLARAAFFLFGNRQEFEALAEAAG-GFRNVDELA---DHLLQSGGT--KVIFVT 284
            :|.........|......|:|||..|....:...| ...:|:::|   ..|.::.||  :...:|
plant   201 FICEFFKDVQEKFLPYMDFVFGNETEARTFSRVHGWETEDVEQIAIKISQLPKATGTYKRTTVIT 265

  Fly   285 NGSAGVQVITNYVEELAPPGPVSFEDFRAQRVEQLVDATGAGDAFVAGFLHAWLEKRSLGECIRM 349
            .|:..|.|..:...:..|..|:.        .|:|||..|||||||.||:...::::|:.||::.
plant   266 QGADPVVVAEDGKVKKYPVIPLP--------KEKLVDTNGAGDAFVGGFMSQLVKEKSIEECVKA 322

  Fly   350 ASSVAAKVVTQVGCNLP 366
            ....:..|:.:.||..|
plant   323 GCYASNVVIQRSGCTYP 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 86/340 (25%)
PTZ00247 28..366 CDD:240328 86/340 (25%)
ADK2NP_195950.1 PTZ00247 11..344 CDD:240328 87/342 (25%)
PLN02548 14..345 CDD:178163 87/342 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1226324at2759
OrthoFinder 1 1.000 - - FOG0003751
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100649
Panther 1 1.100 - - O PTHR45769
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2162
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.780

Return to query results.
Submit another query.