DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ady43A and AT4G28706

DIOPT Version :9

Sequence 1:NP_651995.1 Gene:Ady43A / 44750 FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001190863.1 Gene:AT4G28706 / 828990 AraportID:AT4G28706 Length:440 Species:Arabidopsis thaliana


Alignment Length:433 Identity:78/433 - (18%)
Similarity:130/433 - (30%) Gaps:179/433 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PPTDDTQGAFHTPRKVICFGNVLLDRLVQLED-PQLLERFGLELGSKGELDMEKLNQLAAEASES 79
            ||.|:.        .|:..|.:.:|.|..::. ||                       |.:...|
plant    44 PPPDNA--------IVLGCGGIAVDFLATVDSYPQ-----------------------ADDKIRS 77

  Fly    80 SRCLTNPGGSALNTARILKQLGTDALFFGAVGADKHAEELRQIIRDRGIEARLQTVE-------- 136
            :......||:|.|......:||.::.....|..|...:.:.:.:...|::.....|.        
plant    78 TSLKVQGGGNAANALTCAARLGLNSRLISKVANDSQGKGMLEELEADGVDTSFIVVSKEGNSPFT 142

  Fly   137 ----DAHTGQCVCLMYQ-DNPTLYANIGASAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFF 196
                |..|....|:... |.|.|..::..|                 |.|..::|..|:|.    
plant   143 YILVDNQTKTRTCIHTPGDPPMLPTDLSQS-----------------SMLSALDRASIVYF---- 186

  Fly   197 VPQRSDVCDYIVQHLVRERRRLALNLSAPYIVRKNHQAMMKLARAAFFLFGNRQEFEALAEAAGG 261
                 ||             ||             |:..:.:|:.|     :|::...|.:....
plant   187 -----DV-------------RL-------------HETALVIAKEA-----SRKKIPILVDTEKK 215

  Fly   262 FRNVDEL---ADH------------------------LLQSGGTKVIFVTNGSAGVQVITNY--- 296
            ...:|:|   ||:                        ||:....|.:.||:|..|..::...   
plant   216 RDGLDDLLPFADYVVCPENFPQTWTEVSSTPGALVSMLLRLPKLKFVIVTSGEHGCLMVQRASKA 280

  Fly   297 ---------VEELAP------------PGPVSFEDFR-----------------AQRV--EQLVD 321
                     :|.|..            |..||.|..:                 |:::  |:|||
plant   281 EVFESQETDIESLLETLKHRKDSTTTFPTCVSSETTKLKANGVGTMTGRLFLGTAEKIPPEELVD 345

  Fly   322 ATGAGDAFVAGFLHAWLEKRSLGECIRMASSVAAKVVTQVGCN 364
            .|||||||:...|:|........:.:..|:.||       ||:
plant   346 TTGAGDAFIGAVLYAICAGMPPEKMLPFAAQVA-------GCS 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 75/421 (18%)
PTZ00247 28..366 CDD:240328 75/421 (18%)
AT4G28706NP_001190863.1 ribokinase_group_B 50..393 CDD:238920 75/419 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.