DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ady43A and AT3G59480

DIOPT Version :9

Sequence 1:NP_651995.1 Gene:Ady43A / 44750 FlyBaseID:FBgn0026602 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_191507.1 Gene:AT3G59480 / 825117 AraportID:AT3G59480 Length:326 Species:Arabidopsis thaliana


Alignment Length:372 Identity:80/372 - (21%)
Similarity:123/372 - (33%) Gaps:114/372 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VICFGNVLLDRLVQLEDPQLLERFGLELGSKGELDMEKLNQLAAEASESSRCLTNPGGSALNTAR 95
            ::.||.:|:|.:..:....|.:..|.                          :..|||:..|.|.
plant    11 IVSFGEMLIDFVPTVSGVSLADAPGF--------------------------IKAPGGAPANVAI 49

  Fly    96 ILKQLGTDALFFGAVGADKHAEELRQIIRDRGIEAR-LQTVEDAHTGQCVCLMYQDNP---TLYA 156
            .:.:||..|.|.|.:|.|:....|..|::..|:.|. :.....|.|......:..|..   ..|.
plant    50 AISRLGGRAAFVGKLGDDEFGHMLAGILKQNGVSAEGINFDTGARTALAFVTLRSDGEREFMFYR 114

  Fly   157 NIGASAQFEVQTLSHAVSHEGQSFLRPVERKQILYVEGFFVPQRSDVCDYIVQHLVRERRRLALN 221
            |..|                 ...|||.|    |.::   |.:.:.|..|....|:.|..|.|  
plant   115 NPSA-----------------DMLLRPDE----LNLD---VIRSAKVFHYGSISLIVEPCRSA-- 153

  Fly   222 LSAPYIVRKNHQAMMKLARAA-----------FFLFGNRQEF------------------EALAE 257
                      |...|::|:.|           ..|:.:::|.                  |.|..
plant   154 ----------HLKAMEVAKEAGALLSYDPNLRLPLWPSKEEAQKQILSIWDKAEVIKVSDEELMF 208

  Fly   258 AAGGFRNVDELADHLLQSGGTKVIFVTNGSAGVQVITNYVEELAPPGPVSFEDFRAQRVEQLVDA 322
            ..|..:..||.|..|..| ..|::.||.|..|.:..|........|..|           ..||.
plant   209 LTGSDKVDDETALSLWHS-NLKLLLVTLGEKGCRYYTKSFRGSVDPFHV-----------DAVDT 261

  Fly   323 TGAGDAFVAGFLHAWLEKRS-------LGECIRMASSVAAKVVTQVG 362
            |||||:||...|...::.|:       |.|.:|:|::..|...|:.|
plant   262 TGAGDSFVGALLCKIVDDRAVLEDEARLREVLRLANACGAITTTKKG 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ady43ANP_651995.1 adenosine_kinase 28..366 CDD:238573 80/372 (22%)
PTZ00247 28..366 CDD:240328 80/372 (22%)
AT3G59480NP_191507.1 PLN02323 1..324 CDD:215183 80/372 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.